DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and mthfs

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001120248.1 Gene:mthfs / 100145299 XenbaseID:XB-GENE-982611 Length:204 Species:Xenopus tropicalis


Alignment Length:69 Identity:12/69 - (17%)
Similarity:29/69 - (42%) Gaps:8/69 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SGLDKFAYLRVPSFTAEVPVDQPAR--------LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVH 111
            |.:|:...|.|.::....|.:...|        |.:::...:|..:....:.|..||...|.:.:
 Frog    94 SSVDEINQLPVTTWNIRQPAEGDDRDNALSNGGLDLVLVPGLGFDKEGHRLGRGKGYYDTFLERY 158

  Fly   112 LRRV 115
            ::::
 Frog   159 MKQI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 4/24 (17%)
mthfsNP_001120248.1 5-FTHF_cyc-lig 8..195 CDD:366821 12/69 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165174865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.