DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment brn and tpo

DIOPT Version :9

Sequence 1:	NP_476901.1	Gene:	brn / 31358	FlyBaseID:	FBgn0000221	Length:	325	Species:	Drosophila melanogaster
Sequence 2:	XP_031758614.1	Gene:	tpo / 100036738	XenbaseID:	XB-GENE-920152	Length:	872	Species:	Xenopus tropicalis

Alignment Length:	161	Identity:	33/161 - (20%)
Similarity:	49/161 - (30%)	Gaps:	76/161 - (47%)

- Green bases have known domain annotations that are detailed below.

  Fly   104 EGRFSDV-HLRRVFLLGTAEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNR 167
            |||.::| .|..|..|           | .|||..|.:|          || .|...|.|
Frog   339 EGRANEVITLAAVHTL-----------W-LREHNRIAKA----------LK-KLNPHWNS----- 375

  Fly   168 SEFYLFVDDDYYVSAKNVL--------------KFLGRG------------RQSHQPELLFAGHV 206
                    :..|..|:.::              |.||:.            .|...|.:   .::
Frog   376 --------ETTYQEARKIVGALHQIITFRDYMPKILGKAAYDQYIGLYKGYNQKTNPSI---SNI 429

  Fly   207 FQTS----------PLRHKFSKWYVSLEEYP 227
            |.|:          |:.|:.:..||...:||
Frog   430 FTTAAFRFGHATIPPMVHRLNSQYVDDPKYP 460

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
brn	NP_476901.1	Galactosyl_T	92..282	CDD:250845	33/161 (20%)
tpo	XP_031758614.1	thyroid_peroxidase	116..679	CDD:188657	33/161 (20%)
		CCP	687..736	CDD:153056
		EGF_CA	738..781	CDD:214542
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165174870
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930