DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xpac and xpa

DIOPT Version :9

Sequence 1:NP_476866.1 Gene:Xpac / 31357 FlyBaseID:FBgn0004832 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_956765.1 Gene:xpa / 393443 ZFINID:ZDB-GENE-040426-1205 Length:549 Species:Danio rerio


Alignment Length:280 Identity:125/280 - (44%)
Similarity:167/280 - (59%) Gaps:34/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 STNESAPPAEKKSKLTNAQKARIERNQAKAQKLREAKLVSHPFKELASNKEGGTHPEAALSQGSS 70
            |:|||:      ..||....|:||||:.:|..||:|:|.|.|    :|..||.||.:.|      
Zfish    19 SSNESS------MSLTPHMLAKIERNRQRALMLRQARLASRP----SSAVEGATHAKVA------ 67

  Fly    71 VIKVQGTKYIDSGGGFLLEQPVMPTGVGPAGLNKSGEEAPPILDDAIAIPVQYEECLECGDMFAD 135
                   |.||||.||.:|:..         .....:|...:...|..:...|..|.||...|.|
Zfish    68 -------KTIDSGAGFFIEEET---------TEDEQQEKRVVQQPAPVMEPDYLMCEECQKPFMD 116

  Fly   136 SYLFNNFGHSVCDKCRDKDERYALITRTEAKAEYLLKDCDFDKREPKLRYISRKNPHNVRWGEMK 200
            |||.|:|..||||||||.:.::.||:|||||..|||||||.|||||.||:|.||||||.|||:||
Zfish   117 SYLSNSFDLSVCDKCRDNEVKHKLISRTEAKKNYLLKDCDLDKREPPLRFILRKNPHNPRWGDMK 181

  Fly   201 LYLHLQIHQRALEVWGSEEELVRQHEAREDKREEGKARKYNKKMKQLRMEVRSSIYTKKTHEVHE 265
            |||..|:.:|::|||||:|.|....|.||:.:|..|.:::|||:|:||..||||::.|.| .:|:
Zfish   182 LYLKTQVEKRSMEVWGSDEALEEAKETREENKEVQKQKRFNKKVKELRRTVRSSMFKKDT-SIHQ 245

  Fly   266 HEFGPD-TYDEEEDTYTHTC 284
            |::|.| ..|||||:::..|
Zfish   246 HDYGHDELLDEEEDSFSEKC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XpacNP_476866.1 XPA_N 125..154 CDD:279610 18/28 (64%)
rad14 126..296 CDD:273164 90/160 (56%)
XPA_C 156..207 CDD:282967 36/50 (72%)
xpaNP_956765.1 rad14 107..265 CDD:273164 89/158 (56%)
XPA_N 107..135 CDD:279610 18/27 (67%)
XPA_C 137..188 CDD:282967 36/50 (72%)
DUF4585 401..467 CDD:291885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587042
Domainoid 1 1.000 84 1.000 Domainoid score I8217
eggNOG 1 0.900 - - E1_COG5145
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37298
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1542306at2759
OrthoFinder 1 1.000 - - FOG0005516
OrthoInspector 1 1.000 - - oto41659
orthoMCL 1 0.900 - - OOG6_104388
Panther 1 1.100 - - LDO PTHR10142
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1053
SonicParanoid 1 1.000 - - X5121
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.