DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6414 and ICME-LIKE1

DIOPT Version :9

Sequence 1:NP_001303565.1 Gene:CG6414 / 31352 FlyBaseID:FBgn0029690 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_173937.2 Gene:ICME-LIKE1 / 839153 AraportID:AT1G26120 Length:476 Species:Arabidopsis thaliana


Alignment Length:335 Identity:76/335 - (22%)
Similarity:138/335 - (41%) Gaps:68/335 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PFRRDMILEGSEDCLYLNVYTPERPRTNGSLPVMVWFHGGGWQCG-SGISSFYGPDFLLDHDIVL 161
            |:.|..|:.|.:....|::|.|:  .:.|..||:.:..||.|..| ....|..|.. |.:.||::
plant   178 PYVRRSIVYGDQPRNRLDLYLPK--NSTGPKPVVAFVTGGAWIIGYKAWGSLLGQQ-LSERDIIV 239

  Fly   162 VSANFRLGPLGFLSTETLDCPGNNGLKDQLEVLHWVRANIASFGGDPNSVTVFGESAG----GAS 222
            ...::|..|.|.:|         :.:||....:.:|..:||.:||||:.:.:.|:|||    ..:
plant   240 ACIDYRNFPQGSIS---------DMVKDASSGISFVCNHIAEYGGDPDRIYLMGQSAGAHIAACT 295

  Fly   223 VTYHMLSEKSRGLLHRGIAQSGTYFNPWAQPAHKGVAAG----------------RATKLAQIVG 271
            :...::.|...|   ..::.|.:..|     |:.|::.|                |:..|:.:.|
plant   296 IVEQVIKESGEG---DSVSWSSSQIN-----AYFGLSGGYNLLNLVDHFHSRGLYRSIFLSIMEG 352

  Fly   272 CGNAGEWPEKLECLRKKPAEDIVASLYDMFVWDFDPMIPFPPVVEPEHDGAFLTVAPRQAAKPHG 336
            ..:..::..:| .::....:.|:|.|        .|.|.|       |.....:: |..|:|...
plant   353 EESLRQFSPEL-VVQNPNLKHIIARL--------PPFILF-------HGTDDYSI-PSDASKSFA 400

  Fly   337 LQLPLMVGATAE----EGLLKTAALLNLPQLLAEFKSQFEQVLPVVLNYDHHDDSVRQTITQR-- 395
            ..|. .:||.|:    ||...|...|..| :.......||.::.|||..|  .:::.:::.:|  
plant   401 ETLQ-RLGAKAKVILYEGKTHTDLFLQDP-MRGGIDEMFEDIVTVVLGDD--QEAIGKSVDRRRL 461

  Fly   396 IESFYFKSGH 405
            :..|..|..|
plant   462 VPEFMLKLAH 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6414NP_001303565.1 COesterase 36..567 CDD:278561 76/335 (23%)
Aes <116..>254 CDD:223730 35/142 (25%)
ICME-LIKE1NP_173937.2 Aes 181..420 CDD:223730 62/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2756
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.