DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6414 and PCME

DIOPT Version :9

Sequence 1:NP_001303565.1 Gene:CG6414 / 31352 FlyBaseID:FBgn0029690 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_197090.2 Gene:PCME / 831443 AraportID:AT5G15860 Length:427 Species:Arabidopsis thaliana


Alignment Length:313 Identity:78/313 - (24%)
Similarity:119/313 - (38%) Gaps:71/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RDMILEGSEDCLYLNVYTPERPRTNGSLPVMVWFHGGGWQCG-SGISSFYGPDFLLDHDIVLVSA 164
            |..|:.|.:....|::|.|.  ..:|..||:|:..||.|..| ....|..|.. |.:.||::...
plant   130 RRSIVYGDQPRNRLDLYLPS--NNDGLKPVVVFVTGGAWIIGYKAWGSLLGMQ-LAERDIIVACL 191

  Fly   165 NFRLGPLGFLSTETLDCPGNNGLKDQLEVLHWVRANIASFGGDPNSVTVFGESAGGASVTYHMLS 229
            ::|..|.|.:|....|  .:.|:.       :|..||::||||||.:.:.|:|||.......:|.
plant   192 DYRNFPQGTISDMVTD--ASQGIS-------FVCNNISAFGGDPNRIYLMGQSAGAHIAACALLE 247

  Fly   230 EKSRGLLHRGI----AQSGTYFNPWAQPAHKGVAAG----------------RATKLAQIVGCGN 274
            :.::.|....|    :|...||         |::.|                |:..|:.:.|   
plant   248 QATKELKGESISWTVSQIKAYF---------GLSGGYNLYKLVDHFHNRGLYRSIFLSIMEG--- 300

  Fly   275 AGEWPEKL--ECLRKKPAEDIVASLYDMFVWDFDPMIPFPPVVEPEHDGAFLTVAPRQAAKPHGL 337
             .|..||.  |...|.|.....|||             .||::.......:.............|
plant   301 -EESFEKFSPEVRLKDPVVGKAASL-------------LPPIILFHGSSDYSIPCDESKTFTDAL 351

  Fly   338 QLPLMVGATAEEGLL--KTAALLNLPQLLAEFKSQ-FEQVLPVVLNYDHHDDS 387
            |   .|||.||..|.  ||...|.|...|...|.: |:.::.|:    |.:|:
plant   352 Q---AVGAKAELVLYSGKTHTDLFLQDPLRGGKDELFDDIVSVI----HAEDN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6414NP_001303565.1 COesterase 36..567 CDD:278561 78/313 (25%)
Aes <116..>254 CDD:223730 40/142 (28%)
PCMENP_197090.2 Aes 130..368 CDD:223730 69/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2756
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.