DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6414 and NLGN3

DIOPT Version :9

Sequence 1:NP_001303565.1 Gene:CG6414 / 31352 FlyBaseID:FBgn0029690 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_851820.1 Gene:NLGN3 / 54413 HGNCID:14289 Length:848 Species:Homo sapiens


Alignment Length:659 Identity:182/659 - (27%)
Similarity:267/659 - (40%) Gaps:192/659 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LTTHNGRHMRA--------------FMGVPYAEPPLDDLRFRPPVPKAPWEGERLAIKDAPICLQ 95
            :.||.|:...|              ::|||||.||:.:.||.||.|...|.|.|.|....|:|.|
Human    44 VNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQ 108

  Fly    96 RDP-----------FRRDM------ILEGSEDCLYLNVYTP------------------------ 119
            ...           |..::      |.|.:|||||||||.|                        
Human   109 NIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGG 173

  Fly   120 ------------------ERPRTNGSLPVMVWFHGGGWQCGSG------ISSFYGPDFLLDHDIV 160
                              |..|.:|:.||||:.|||.:..|:|      |.:.||       :::
Human   174 SGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSILASYG-------NVI 231

  Fly   161 LVSANFRLGPLGFLSTETLDCPGNNGLKDQLEVLHWVRANIASFGGDPNSVTVFGESAGGASVTY 225
            :::.|:|:|.||||||......||.||.||::.|.||..|||.|||||..:||||...|.:.|:.
Human   232 VITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSL 296

  Fly   226 HMLSEKSRGLLHRGIAQSGTYFNPWA---QPAHKGVAAGRATKLAQIVGCGNAGEWPEKLECLRK 287
            ..||..|.||..|.|.|||:..:.||   ||..      ..:.||..||| |..:..:.::|||:
Human   297 LTLSHHSEGLFQRAIIQSGSALSSWAVNYQPVK------YTSLLADKVGC-NVLDTVDMVDCLRQ 354

  Fly   288 KPAEDIVASLYDMFVWDFDPM---IPFPPVV-------EPE---HDGAFLTVAPRQAAKPHGLQL 339
            |.|:::|..       |..|.   :.|.||:       :||   ..|.|             |..
Human   355 KSAKELVEQ-------DIQPARYHVAFGPVIDGDVIPDDPEILMEQGEF-------------LNY 399

  Fly   340 PLMVGATAEEGLLKTAALLNLPQLLA--EFKSQFEQVLPVVLNYDHHDDSVRQTITQRIESFYFK 402
            .:|:|....|||.....:::....::  :|.......:..:..|....|::|:||     .|.:.
Human   400 DIMLGVNQGEGLKFVEGVVDPEDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETI-----KFMYT 459

  Fly   403 SGHDYD--KANHQNLTDLISDGWFV--AGIDEYLRLRMSQEDVAPTYVYLFDH------KGAASF 457
            ...|.|  :...:.|..|.:|..:|  :.:...|..|..    :|||.|.|.|      |.|.| 
Human   460 DWADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARYG----SPTYFYAFYHHCQSLMKPAWS- 519

  Fly   458 TEIFKGGRNEFYGACHAEELQYLFPI----GRELFVSAVP---TQKDLELRELMLHLWVSFAKTG 515
                        .|.|.:|:.|:|.:    ..:||    |   ::.|:.|..:::..|.:|||||
Human   520 ------------DAAHGDEVPYVFGVPMVGPTDLF----PCNFSKNDVMLSAVVMTYWTNFAKTG 568

  Fly   516 NPN---PTNVSF-HLP-------NWSPASSYPVEFARLGTKMEDSASIFRLENELMQHRVDFWRD 569
            :||   |.:..| |..       .||..:.....:..:|.|.       |:.:.....:|.||:.
Human   569 DPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGLKP-------RVRDHYRATKVAFWKH 626

  Fly   570 LQPHLPASH 578
            |.|||...|
Human   627 LVPHLYNLH 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6414NP_001303565.1 COesterase 36..567 CDD:278561 175/646 (27%)
Aes <116..>254 CDD:223730 63/188 (34%)
NLGN3NP_851820.1 COesterase 36..624 CDD:278561 175/646 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..195 1/24 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.