DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6414 and Nceh1

DIOPT Version :10

Sequence 1:NP_570089.1 Gene:CG6414 / 31352 FlyBaseID:FBgn0029690 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_848887.1 Gene:Nceh1 / 320024 MGIID:2443191 Length:408 Species:Mus musculus


Alignment Length:122 Identity:35/122 - (28%)
Similarity:49/122 - (40%) Gaps:26/122 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 ILEGSEDCLYLNVYTPERPRTNGSLPVMVWFHGGGWQCGSGISSFYGPDFLL-----DHDIVLVS 163
            :.|||.        .||.|....    :::.|||||...|...|:|  |.|.     :.:.|:||
Mouse    94 VFEGSP--------KPEEPLRRS----VIYIHGGGWALASAKISYY--DQLCTTMAEELNAVIVS 144

  Fly   164 ANFRLGPLGFLSTETLDCPGNNGLKDQLEVLHWVRANIASFGGDPNSVTVFGESAGG 220
            ..:||.|..:...:..|.........|.|||.       .:..||..|.:.|:||||
Mouse   145 IEYRLVPQVYFPEQIHDVIRATKYFLQPEVLD-------KYKVDPGRVGISGDSAGG 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6414NP_570089.1 COesterase 28..567 CDD:395084 35/122 (29%)
Nceh1NP_848887.1 Abhydrolase_3 109..381 CDD:400284 29/95 (31%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 113..115 1/1 (100%)

Return to query results.
Submit another query.