DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6414 and Cel

DIOPT Version :9

Sequence 1:NP_001303565.1 Gene:CG6414 / 31352 FlyBaseID:FBgn0029690 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_058693.2 Gene:Cel / 24254 RGDID:2331 Length:612 Species:Rattus norvegicus


Alignment Length:601 Identity:169/601 - (28%)
Similarity:272/601 - (45%) Gaps:121/601 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SHGGWL--IGRHLTTHNGRHMRAFMGVPYAEPPLDDLRFRPPVPKAPWEGERLAIKDAPICLQRD 97
            :.||::  :.:.|:...|..:..|.|:|:|.....:...|.|    .|:|...|......|||..
  Rat    28 TEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAKTLENPQRHP----GWQGTLKATDFKKRCLQAT 88

  Fly    98 PFRRDMILEGSEDCLYLNVYTPE-RPRTNGSLPVMVWFHGGGWQCGSGISSFYGPDFLLDHD--- 158
            ..:.|..  |.|||||||::.|: |.:.:..||||||.:||.:..|||..:.:..::|.|.:   
  Rat    89 ITQDDTY--GQEDCLYLNIWVPQGRKQVSHDLPVMVWIYGGAFLMGSGQGANFLKNYLYDGEEIA 151

  Fly   159 ----IVLVSANFRLGPLGFLSTETLDCPGNNGLKDQLEVLHWVRANIASFGGDPNSVTVFGESAG 219
                :::|:.|:|:||||||||...:.|||.||:||...:.||:.|||:|||||:::|:||||||
  Rat   152 TRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPDNITIFGESAG 216

  Fly   220 GASVTYHMLSEKSRGLLHRGIAQSGTYFNPWAQPAH-----KGVA--AGRATK-LAQIVGCGNAG 276
            .|||:...||..::||:.|.|:|||...:|||...:     |.:|  .|..|: .|::.||....
  Rat   217 AASVSLQTLSPYNKGLIRRAISQSGVALSPWAIQENPLFWAKTIAKKVGCPTEDTAKMAGCLKIT 281

  Fly   277 EWPEKLECLRKKPAEDIVASLYDMFVWDFDPMIPFPPVVEPEHDGAFLTVAPRQAAKPHGLQLPL 341
            : |..|....:.|   :.:..|.:..:     :.|.|||    ||.|:...|.. ...:...:..
  Rat   282 D-PRALTLAYRLP---LKSQEYPIVHY-----LAFIPVV----DGDFIPDDPIN-LYDNAADIDY 332

  Fly   342 MVGATAEEGLLKTAALLNLPQLLAEFKSQFEQVLPVVLNYDHHDDSVRQTITQRIESFY-FKSGH 405
            :.|....:|.|  .|.:::|.:                      |..:|.:|:  |.|| ..|||
  Rat   333 LAGINDMDGHL--FATVDVPAI----------------------DKAKQDVTE--EDFYRLVSGH 371

  Fly   406 DYDKA--NHQNLTDLISDGW---------------------FVAGIDEYLRLRMSQEDVAPTYVY 447
            ...|.  ..|...|:.::.|                     |:...:..|....:....|.||.|
  Rat   372 TVAKGLKGTQATFDIYTESWAQDPSQENMKKTVVAFETDILFLIPTEMALAQHRAHAKSAKTYSY 436

  Fly   448 LFDHKGAASFTEIFKGGRNEFYGACHAEELQYLF------PIGRELFVSAVPTQKDLELRELMLH 506
            ||.|   .|...|:.    ::.||.||::|||:|      |:|..        .:|..:.:.|:.
  Rat   437 LFSH---PSRMPIYP----KWMGADHADDLQYVFGKPFATPLGYR--------AQDRTVSKAMIA 486

  Fly   507 LWVSFAKTGNPNPTN--VSFHLPNWSPASSYPVEFARLGTKMEDSASIFRLENELMQHRVDFWR- 568
            .|.:|||:|:||..|  |..|   |.|.::....:..:..|:..::    ::..|.:..:.||. 
  Rat   487 YWTNFAKSGDPNMGNSPVPTH---WYPYTTENGNYLDINKKITSTS----MKEHLREKFLKFWAV 544

  Fly   569 --DLQPHLPASHAHNE 582
              ::.|.:...|...|
  Rat   545 TFEMLPTVVGDHTPPE 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6414NP_001303565.1 COesterase 36..567 CDD:278561 164/580 (28%)
Aes <116..>254 CDD:223730 65/145 (45%)
CelNP_058693.2 COesterase 26..542 CDD:278561 164/581 (28%)
Aes <118..>247 CDD:223730 60/128 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..612 2/8 (25%)
4 X 11 AA tandem repeats, O-glycosylated region 556..599 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.