DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6414 and Nlgn2

DIOPT Version :9

Sequence 1:NP_001303565.1 Gene:CG6414 / 31352 FlyBaseID:FBgn0029690 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001351066.1 Gene:Nlgn2 / 216856 MGIID:2681835 Length:836 Species:Mus musculus


Alignment Length:611 Identity:186/611 - (30%)
Similarity:264/611 - (43%) Gaps:147/611 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FMGVPYAEPPLDDLRFRPPVPKAPWEGERLAIKDAPICLQRDPFRRDMILEG------------- 107
            |:|||||.|||...||:||...|.|.|.|.|....|.|.|.        |.|             
Mouse    69 FLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQN--------LHGALPAIMLPVWFTD 125

  Fly   108 ------------SEDCLYLNVYTPERP-------------------RTNGSLPVMVWFHGGGWQC 141
                        ||||||||:|.|...                   |.:|..|||::.|||.:..
Mouse   126 NLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDSGKKPVMLFLHGGSYME 190

  Fly   142 GSGISSFYGPDFLLDHDIVLVSANFRLGPLGFLSTETLDCPGNNGLKDQLEVLHWVRANIASFGG 206
            |:| :.|.|.......::::|:.|:|||.||||||......||.||.||::.|.|:..|||.|||
Mouse   191 GTG-NMFDGSVLAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGG 254

  Fly   207 DPNSVTVFGESAGGASVTYHMLSEKSRGLLHRGIAQSGTYFNPWA---QPAHKGVAAGRATK-LA 267
            ||..:|:||..||.:.|...:||..|.||..:.||||||..:.|:   ||.       :.|: ||
Mouse   255 DPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQPL-------KYTRLLA 312

  Fly   268 QIVGCGNAGEWPEKLECLRKKPAEDIVASLYDMFVWDFDPM---IPFPPVV-------EPE---H 319
            ..||| :..:..|.:||||:|.:.::|..       |..|.   |.|.|||       :||   .
Mouse   313 AKVGC-DREDSTEAVECLRRKSSRELVDQ-------DVQPARYHIAFGPVVDGDVVPDDPEILMQ 369

  Fly   320 DGAFLTVAPRQAAKPHGLQLPLMVGATAEEGL--LKTAALLNLPQLLAEFKSQFEQVLPVVLNYD 382
            .|.|             |...:::|....|||  ::.:|........:.|.......:..:..|.
Mouse   370 QGEF-------------LNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYP 421

  Fly   383 HHDDSVRQTITQRIESFYFKSGHDYD--KANHQNLTDLISDGWFVAGIDEYLRLRMSQEDVAPTY 445
            ...|.:|:||     .|.:....|.|  :...:.|..|.:|..:||......:|....:  :|.|
Mouse   422 EGKDVLRETI-----KFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQ--SPVY 479

  Fly   446 VYLFDHKGAASFTEIFKGGRNEFYGACHAEELQYLFPI----GRELFVSAVP---TQKDLELREL 503
            .|.|.|...|.       ||.|:..|.|.:||.|:|.:    ..:||    |   ::.|:.|..:
Mouse   480 FYTFYHHCQAE-------GRPEWADAAHGDELPYVFGVPMVGATDLF----PCNFSKNDVMLSAV 533

  Fly   504 MLHLWVSFAKTGNPN---PTNVSF-HL-PN------WSPASSYPVEFARLGTKMEDSASIFRLEN 557
            ::..|.:|||||:||   |.:..| |. ||      ||..:|...::..:|.|.       |:.:
Mouse   534 VMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKP-------RVRD 591

  Fly   558 ELMQHRVDFWRDLQPHLPASHAHNEL 583
            ....::|.||.:|.|||  .:.|.||
Mouse   592 NYRANKVAFWLELVPHL--HNLHTEL 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6414NP_001303565.1 COesterase 36..567 CDD:278561 177/593 (30%)
Aes <116..>254 CDD:223730 60/159 (38%)
Nlgn2NP_001351066.1 COesterase 42..601 CDD:306613 177/593 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..661
Required for interaction with LHFPL4. /evidence=ECO:0000269|PubMed:28279354 679..699
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 711..735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..836
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.