DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tal1 and Fer1

DIOPT Version :9

Sequence 1:NP_001101428.2 Gene:Tal1 / 313507 RGDID:1306748 Length:329 Species:Rattus norvegicus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:212 Identity:60/212 - (28%)
Similarity:88/212 - (41%) Gaps:59/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat   145 ASLGSG--FFG---------EPDAFPMFTNNNR----------VKRRPSPYEMEITDGPHTKVVR 188
            ||..|.  |||         |.||:....|:::          .:|...|..::...   ....:
  Fly    26 ASTSSSDYFFGDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCAS---QMAQQ 87

  Rat   189 RIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQR 253
            |...|.|||.|.|::|.||..||..|||.|.:|:|||.:.|:||:.||.||::::. :::.|.: 
  Fly    88 RQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVK-KDKNGNE- 150

  Rat   254 AKPG--------KDPMVGAGGGGAGGGIPPEDLLQDVLSPNSSCGSSLD----GAASPDS--YTE 304
              ||        |:|             |.:.:|:|   .......||.    |...|.|  |..
  Fly   151 --PGLSLQRNYQKEP-------------PKKIILKD---RTGGVAHSLSWYRKGDRYPGSKLYAR 197

  Rat   305 EPTPKHTPRSLHPALLP 321
            ..||: .||..|...||
  Fly   198 TWTPE-DPRGPHSQPLP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tal1NP_001101428.2 bHLH_TS_TAL1 185..249 CDD:381549 27/63 (43%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.