DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and VAPA

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_003565.4 Gene:VAPA / 9218 HGNCID:12648 Length:294 Species:Homo sapiens


Alignment Length:290 Identity:105/290 - (36%)
Similarity:149/290 - (51%) Gaps:40/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            |.::|..:|:|.||||..|.|.:.|||.|...:.||:|||||:|||||||.|.|.|..:..|.:.
Human    15 LVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVM 79

  Fly    75 LQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMPTAEANAENT 139
            ||||.||..||:|||||||::.||  .:.||:..:||:.:|::|||:||:||||||.     ||.
Human    80 LQPFDYDPNEKSKHKFMVQTIFAP--PNTSDMEAVWKEAKPDELMDSKLRCVFEMPN-----END 137

  Fly   140 SGGGAVGGGTGAAGGGSAGANT--SSASAEALESKPKLSSEDKFKPSNLLETSESLDLLSGE--- 199
            ..|....|........|:..||  :.||....:....||...:.|..|.:|.|:::.|.:.:   
Human   138 KLGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDG 202

  Fly   200 ---------------IKALRECN------IELRRENLHLKDQITRFRSSPAVKQVNEPYAPVLAE 243
                           .|.:.||.      ::|..||.||:|:..|.|.   |...::|.:...|.
Human   203 PMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRK---VAHSDKPGSTSTAS 264

  Fly   244 KQ----IPVFYIAVAIAAAIVSLLLGKFFL 269
            .:    .|:..:.|.|||..:...||||.|
Human   265 FRDNVTSPLPSLLVVIAAIFIGFFLGKFIL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 53/104 (51%)
VAPANP_003565.4 Motile_Sperm 14..118 CDD:395510 53/104 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158291
Domainoid 1 1.000 113 1.000 Domainoid score I6143
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4318
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332028at2759
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 1 1.000 - - otm40462
orthoMCL 1 0.900 - - OOG6_101143
Panther 1 1.100 - - LDO PTHR10809
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2279
SonicParanoid 1 1.000 - - X526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.