DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and VAPB

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_004729.1 Gene:VAPB / 9217 HGNCID:12649 Length:243 Species:Homo sapiens


Alignment Length:264 Identity:97/264 - (36%)
Similarity:142/264 - (53%) Gaps:32/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            |::||:|||:|.||||..|.|.:.|.|.:...:.||:|||||:|||||||.|.|....|..|.:.
Human     8 LSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVM 72

  Fly    75 LQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMPTAEANAENT 139
            ||||.||..||:||||||||:.||  .|.||:..:||:.:||.|||:||:||||:|.......:.
Human    73 LQPFDYDPNEKSKHKFMVQSMFAP--TDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDV 135

  Fly   140 SGGGAVGGGTGAAGGGSAGANTSSASAEALESKPKLSSEDKFKPSNLLETSESLDLLSGEIKALR 204
            .....:             :.|:|.:...:.||...||.|..:...::|..:.   |.||::.||
Human   136 EINKII-------------STTASKTETPIVSKSLSSSLDDTEVKKVMEECKR---LQGEVQRLR 184

  Fly   205 ECNIELRREN-LHLKDQITRFRSSPAVKQVNEP---YAPVLAEKQIPVFYIAVAIAAAIVSLLLG 265
            |.|.:.:.|: |.::..:          |.|.|   .||...|:.:....:|:.:...||.:::|
Human   185 EENKQFKEEDGLRMRKTV----------QSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIG 239

  Fly   266 KFFL 269
            |..|
Human   240 KIAL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 56/104 (54%)
VAPBNP_004729.1 Motile_Sperm 8..111 CDD:395510 56/104 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158289
Domainoid 1 1.000 113 1.000 Domainoid score I6143
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36163
Inparanoid 1 1.050 155 1.000 Inparanoid score I4318
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332028at2759
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 1 1.000 - - otm40462
orthoMCL 1 0.900 - - OOG6_101143
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2279
SonicParanoid 1 1.000 - - X526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.