DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and SCS22

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_009461.2 Gene:SCS22 / 852186 SGDID:S000007228 Length:175 Species:Saccharomyces cerevisiae


Alignment Length:176 Identity:48/176 - (27%)
Similarity:80/176 - (45%) Gaps:32/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            :.|.|| :|.|..|..:.....:.|.|:....::||::|:||.:||||||:..|....|..|:|.
Yeast     1 MRIVPE-KLVFKAPLNKQSTEYIKLENDGEKRVIFKVRTSAPTKYCVRPNVAIIGAHESVNVQIV 64

  Fly    75 L----QPFVYDQQEKNKHKFMVQSVLAP---MDADLSDLNKLWKDLEPEQLMD----AKLKCVFE 128
            .    :....|:.::.:.||::.::..|   .:.:..:|...|.:|| ||..|    .|:|....
Yeast    65 FLGLPKSTADDEMDQKRDKFLIVTLPIPAAYQNVEDGELLSDWPNLE-EQYKDDIVFKKIKIFHS 128

  Fly   129 M-----PTAEANAENTSGGGAVGGGTGAAGGGSAGANTSSASAEAL 169
            :     |:...:||             :|...||| |..|.|:.||
Yeast   129 VLPKRKPSGNHDAE-------------SARAPSAG-NGQSLSSRAL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 30/111 (27%)
SCS22NP_009461.2 Motile_Sperm 1..107 CDD:395510 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344959
Domainoid 1 1.000 58 1.000 Domainoid score I2623
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I1817
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 1 1.000 - - mtm9170
orthoMCL 1 0.900 - - OOG6_101143
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2279
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.