DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and AT1G51270

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001154418.1 Gene:AT1G51270 / 841550 AraportID:AT1G51270 Length:637 Species:Arabidopsis thaliana


Alignment Length:327 Identity:76/327 - (23%)
Similarity:121/327 - (37%) Gaps:94/327 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIP 65
            ||..|    |.|:|. :::|.....:.|...:.|.|.:...:.||.|||..|:|.||||:|.::|
plant   172 MSDEL----LIIDPV-DVQFPIELNKKVSCSLNLTNKTENYVAFKAKTTNAKKYYVRPNVGVVLP 231

  Fly    66 FRSTQVEICLQPF---VYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLM-------- 119
            ..|.:|.:.:|..   ..|.|.::|..|..:.|.....|         ||:..|...        
plant   232 RSSCEVLVIMQALKEAPADMQCRDKLLFQCKVVEPETTA---------KDVTSEMFSKEAGHPAE 287

  Fly   120 DAKLKCVF------EMPTAEANAENTSGGGAVGGGTGAAGGGSAGANTSSASAEALE-------S 171
            :.:||.::      ..|..|...|.:|...:|          |...|.|.|..:.|.       |
plant   288 ETRLKVMYVTPPQPPSPVQEGTEEGSSPRASV----------SDNGNASEAFVDMLRSLLVPLFS 342

  Fly   172 KPKLSSED------------KFKPSNLLETSESLDLLSGEIKALR--ECN-----IELRRENL-H 216
            ....|::|            .|:...|..:     .:...:||:|  :.|     :|||..|| :
plant   343 NAASSTDDHGITLPQYQVFINFRGDELRNS-----FVGFLVKAMRLEKINVFTDEVELRGTNLNY 402

  Fly   217 LKDQITRFRSSPAVKQVNEPYAP--------VLAEKQ--------IPVFYIAVAIAAAIVSLLLG 265
            |..:|...|.:.|:  .:|.|..        |..::|        :||||   .:.|......:|
plant   403 LFRRIEESRVAVAI--FSERYTESCWCLDELVKMKEQMEQGKLVVVPVFY---RLNATACKRFMG 462

  Fly   266 KF 267
            .|
plant   463 AF 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 31/108 (29%)
AT1G51270NP_001154418.1 Motile_Sperm 6..113 CDD:279029
Motile_Sperm 176..283 CDD:279029 33/120 (28%)
TIR 357..492 CDD:214587 26/118 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3931
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332028at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.