DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and VAP27-2

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001031004.1 Gene:VAP27-2 / 837404 AraportID:AT1G08820 Length:386 Species:Arabidopsis thaliana


Alignment Length:268 Identity:62/268 - (23%)
Similarity:108/268 - (40%) Gaps:42/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            |.|:| ..|:|.....:....::.|.|.:...:.||:|||:||:||||||:|.:.|..:.:..:.
plant     6 LDIQP-RTLQFAVDLKKQTSCVVQLTNTTHHYVAFKVKTTSPKKYCVRPNVGVVAPKSTCEFTVI 69

  Fly    75 LQPFVYDQQEK-NKHKFMVQSVLAPMDADLSDLN-KLWKDLEPEQLMDAKLKCVFEMP--TAEAN 135
            :|.|.....:. .|.||::||.....:....|:. .::...|.:.:.:.||:.....|  :.|.:
plant    70 MQAFKEPPPDMVCKDKFLIQSTAVSAETTDEDITASMFSKAEGKHIEENKLRVTLVPPSDSPELS 134

  Fly   136 AENTSGGGAV---------------------GGGTGAAGGGSAGANTSSASAEALESK-PKLSS- 177
            ..||...|||                     ..|.........|.:...|:..|.|.| ||::: 
plant   135 PINTPKQGAVFEDSILKDRLYSQSETLAPPQYEGEIVKEPRMVGHDELKAADNAKELKTPKMATV 199

  Fly   178 ---EDKFKPSNLLETSESLDLLSGEIKALRECNIELRRENLHLKDQITRFRSSPAVKQVNEPYAP 239
               ||::..::|..|.:|.|    ..:..:|...:..|.:....|       ..|:|......||
plant   200 DFVEDRYTANDLKATKDSYD----SSRMAKETGFDPIRSHKDADD-------GRAIKATTNLDAP 253

  Fly   240 VLAEKQIP 247
            :.....:|
plant   254 MKKAMDLP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 30/106 (28%)
VAP27-2NP_001031004.1 Motile_Sperm 5..113 CDD:279029 31/107 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3931
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332028at2759
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.