DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and MAMI

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_568804.1 Gene:MAMI / 835498 AraportID:AT5G54110 Length:266 Species:Arabidopsis thaliana


Alignment Length:188 Identity:50/188 - (26%)
Similarity:77/188 - (40%) Gaps:53/188 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKSLFDLP----LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIG 61
            :::||  ||    |.::|...|.|.....:.|.:.:.|:|.|.....||.:|||||...:||..|
plant    66 VARSL--LPARRRLRLDPSSYLYFPYEPGKQVRSAIKLKNTSKSHTAFKFQTTAPKSCYMRPPGG 128

  Fly    62 KIIPFRS---TQVEICLQPFVYDQQ---EKNKHKFMVQSV-LAP--------------------- 98
            .:.|..|   |..:....|...::|   :|:|.||.:.|: :.|                     
plant   129 VLAPGESVFATVFKFVEHPENNEKQPLNQKSKVKFKIMSLKVKPGVEYVPELFDEQKDQVAVEQV 193

  Fly    99 -----MDAD--LSDLNKLWKDL-EPEQLMDAKLKCVFEMPTAEANAENTSGGGAVGGG 148
                 :|||  .:.|.||.:.| |.|..::|:.|     |..|      :|...||.|
plant   194 LRVIFIDADRPSAALEKLKRQLDEAEAAVEARKK-----PPPE------TGPRVVGEG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 37/145 (26%)
MAMINP_568804.1 Motile_Sperm 80..189 CDD:395510 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.