DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and AT5G47180

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_199529.1 Gene:AT5G47180 / 834764 AraportID:AT5G47180 Length:220 Species:Arabidopsis thaliana


Alignment Length:208 Identity:55/208 - (26%)
Similarity:97/208 - (46%) Gaps:35/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            ::|:|: ||:|:....:.....:.:.|.:...:.||:|||:||:|.||||.|.|.|:.|..:.:.
plant    10 ISIQPD-ELKFLFELEKQSYCDLKVANKTENYVAFKVKTTSPKKYFVRPNTGVIQPWDSCIIRVT 73

  Fly    75 LQ-PFVYDQQEKNKHKFMVQSVLAPMDADLSDL--NKLWKDLEPEQLMDAKLKCVFEMPTAEANA 136
            || ...|....:.|.||::||.:.|...|:.:|  :...|| ..:.|.:.|||..:..|   :..
plant    74 LQAQREYPPDMQCKDKFLLQSTIVPPHTDVDELPQDTFTKD-SGKTLTECKLKVSYITP---STT 134

  Fly   137 ENTSGGGAVGGGTGAAGGGSAGANTSSASAEALESKPKLSSEDKFKPSNLLETSESLDLLSGEIK 201
            :.:|..||..|              ...|:|.:.:..:|..|   :.:.:.:|.:    |..|::
plant   135 QRSSESGATNG--------------DGQSSETISTIQRLKEE---RDAAVKQTQQ----LQHELE 178

  Fly   202 ALRECNIELRREN 214
            .:|      ||.|
plant   179 TVR------RRRN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 35/107 (33%)
AT5G47180NP_199529.1 Motile_Sperm 9..116 CDD:395510 35/107 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3931
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I2526
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332028at2759
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 1 1.000 - - otm2805
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.