DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and AT4G21450

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001190786.1 Gene:AT4G21450 / 826300 AraportID:AT4G21450 Length:314 Species:Arabidopsis thaliana


Alignment Length:146 Identity:43/146 - (29%)
Similarity:63/146 - (43%) Gaps:36/146 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LRFVGPFTRP---VVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEICLQPFV 79
            |:|:. |..|   |.:.:.::|.|...:.||.:|||||...:||. |.|:....|.:....: ||
plant   133 LKFLS-FNEPGKQVRSAIKIKNTSKSHVAFKFQTTAPKSCFMRPP-GAILAPGETIIATVFK-FV 194

  Fly    80 ---------YDQQEKNKHKFMVQSVLAPMD--ADLSDLNKLWKDLEPEQLMDAKLKCVFEMP--- 130
                     .||:.:.|.|.|...|..|||  .:|.|..|  .|:..||:    |:.:|..|   
plant   195 EPPENNEKPMDQRSRVKFKIMSLKVKGPMDYVPELFDEQK--DDVSKEQI----LRVIFLDPERS 253

  Fly   131 ----------TAEANA 136
                      .|||:|
plant   254 NPALEKLKRQLAEADA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 34/110 (31%)
AT4G21450NP_001190786.1 Motile_Sperm 108..239 CDD:279029 34/110 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3537
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.