DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and VAP27-1

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_567101.1 Gene:VAP27-1 / 825231 AraportID:AT3G60600 Length:256 Species:Arabidopsis thaliana


Alignment Length:287 Identity:70/287 - (24%)
Similarity:117/287 - (40%) Gaps:90/287 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            ||:|| .:|:|.....:.:...:.|.|.:...:.||:|||.||:||||||.|.::|..:.:|.:.
plant    23 LTVEP-LDLQFPFELKKQISCSLYLTNKTDNNVAFKVKTTNPKKYCVRPNTGVVLPRSTCEVLVT 86

  Fly    75 LQPFVYDQQE-----KNKHKFMVQSVLAPMDADLSDLNKLWKDLEPE--------QLMDAKLKCV 126
            :|.    |:|     :.|.||::|.|:|......       |::.||        ::.:.||:..
plant    87 MQA----QKEAPSDMQCKDKFLLQGVIASPGVTA-------KEVTPEMFSKEAGHRVEETKLRVT 140

  Fly   127 F------EMPTAEANAENTSGGGAVGGGTGAAGGGS------------AGANTSSASAEALESKP 173
            :      ..|..|.:.|.:|...:|...    |.||            ||...:::.|.||.:| 
plant   141 YVAPPRPPSPVHEGSEEGSSPRASVSDN----GHGSEFSFERFIVDNKAGHQENTSEARALITK- 200

  Fly   174 KLSSEDKFKPSNLLETSESLDLLSGEIKALRECNIELRRENLHLKDQITRFRSSPAVKQVNEPYA 238
                        |.|..:|...|:..::  ||.: :||||:  .|.|                  
plant   201 ------------LTEEKQSAIQLNNRLQ--RELD-QLRRES--KKSQ------------------ 230

  Fly   239 PVLAEKQIPVFYIAVAIAAAIVSLLLG 265
                ...||..|:   :...::.|:||
plant   231 ----SGGIPFMYV---LLVGLIGLILG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 34/109 (31%)
VAP27-1NP_567101.1 Motile_Sperm 22..129 CDD:334183 36/117 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3931
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332028at2759
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101143
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.