DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and PVA12

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_182039.1 Gene:PVA12 / 819122 AraportID:AT2G45140 Length:239 Species:Arabidopsis thaliana


Alignment Length:277 Identity:69/277 - (24%)
Similarity:121/277 - (43%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIP 65
            ||..|    |||:|. :|:|.....:.:...:.|.|.:...:.||:|||.||:||||||.|.:.|
plant     1 MSNEL----LTIDPV-DLQFPFELKKQISCSLYLGNKTDNYVAFKVKTTNPKKYCVRPNTGVVHP 60

  Fly    66 FRSTQVEICLQPFVYDQQE-----KNKHKFMVQSVLAPMDADLSDL-NKLWKDLEPEQLMDAKLK 124
            ..|::|.:.:|.    |:|     :.|.||::|.|:|...|...|: ::::......::.:.||:
plant    61 RSSSEVLVTMQA----QKEAPADLQCKDKFLLQCVVASPGATPKDVTHEMFSKEAGHRVEETKLR 121

  Fly   125 CVF------EMPTAEANAENTSGGGAVGGGTGAAGGGSAGANTSSASAEALESKPKLSSEDKFKP 183
            .|:      ..|..|.:.|.:|...:|          |...|.|..:|....|..::.::|....
plant   122 VVYVAPPRPPSPVREGSEEGSSPRASV----------SDNGNASDFTAAPRFSADRVDAQDNSSE 176

  Fly   184 SNLLETSESLDLLSGEIKALRECNIELRRENLHLKDQITRFRSSPAVKQVNEPYAPVLAEKQIPV 248
            :..|.|.     |:.|..:..:.|..|::|...|:.:..|.:|.                 .||.
plant   177 ARALVTK-----LTEEKNSAVQLNNRLQQELDQLRRESKRSKSG-----------------GIPF 219

  Fly   249 FYIAVAIAAAIVSLLLG 265
            .|:   :...::.|:||
plant   220 MYV---LLVGLIGLILG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 36/111 (32%)
PVA12NP_182039.1 Motile_Sperm 5..112 CDD:395510 37/115 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3931
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332028at2759
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101143
Panther 1 1.100 - - LDO PTHR10809
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.