DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and Mospd2

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_011246175.1 Gene:Mospd2 / 76763 MGIID:1924013 Length:529 Species:Mus musculus


Alignment Length:200 Identity:46/200 - (23%)
Similarity:89/200 - (44%) Gaps:44/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SLFDLPLT-IEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFR 67
            |:|..||. |.|..||.|....:....|::.|.|.:...:.||::||||::|.|:|:.....|  
Mouse   332 SVFKGPLLHISPAEELYFGSIESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDP-- 394

  Fly    68 STQVEICLQP---FVYDQQEKNKHKFMVQSVLAPMDADL----SDLNKLWKDLEPEQLMDAKLKC 125
            ...::|.:.|   .....|:    :|::.:  |.|:...    ::|::.||::...::|:.:|:|
Mouse   395 GASIDIIVSPHGGLTVSAQD----RFLIMA--AEMEQSSGTGPAELSQFWKEVPRNKVMEHRLRC 453

  Fly   126 VFEMPTAEANAENTSGGGAVGGGTGAAGGGSAGANTSSASAEALESKPKLSSEDKFKPSN-LLET 189
                .|.|::..|                       |....:::.:....:|||.:...| |||:
Mouse   454 ----HTVESSKPN-----------------------SLMLKDSISTMSDKTSEDLYLQLNRLLES 491

  Fly   190 SESLD 194
            :..|:
Mouse   492 NRKLE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 29/113 (26%)
Mospd2XP_011246175.1 CRAL_TRIO 101..245 CDD:366224
Motile_Sperm 338..442 CDD:334183 28/111 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.