Sequence 1: | NP_570087.1 | Gene: | Vap33 / 31349 | FlyBaseID: | FBgn0029687 | Length: | 269 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011246175.1 | Gene: | Mospd2 / 76763 | MGIID: | 1924013 | Length: | 529 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 46/200 - (23%) |
---|---|---|---|
Similarity: | 89/200 - (44%) | Gaps: | 44/200 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 SLFDLPLT-IEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFR 67
Fly 68 STQVEICLQP---FVYDQQEKNKHKFMVQSVLAPMDADL----SDLNKLWKDLEPEQLMDAKLKC 125
Fly 126 VFEMPTAEANAENTSGGGAVGGGTGAAGGGSAGANTSSASAEALESKPKLSSEDKFKPSN-LLET 189
Fly 190 SESLD 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vap33 | NP_570087.1 | Motile_Sperm | 9..115 | CDD:279029 | 29/113 (26%) |
Mospd2 | XP_011246175.1 | CRAL_TRIO | 101..245 | CDD:366224 | |
Motile_Sperm | 338..442 | CDD:334183 | 28/111 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5066 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |