powered by:
Protein Alignment Vap33 and MOSPD3
DIOPT Version :9
Sequence 1: | NP_570087.1 |
Gene: | Vap33 / 31349 |
FlyBaseID: | FBgn0029687 |
Length: | 269 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001035186.1 |
Gene: | MOSPD3 / 64598 |
HGNCID: | 25078 |
Length: | 235 |
Species: | Homo sapiens |
Alignment Length: | 60 |
Identity: | 17/60 - (28%) |
Similarity: | 31/60 - (51%) |
Gaps: | 7/60 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 IMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEICLQ-----PFVYDQQEK 85
::||.|.:...|.|::..|||.:|.|....|.:.| .:.::|.:: |..||.|::
Human 54 LLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKP--QSCIDIVIRHVAPIPSHYDVQDR 111
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5066 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10809 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.