DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and MOSPD3

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001035186.1 Gene:MOSPD3 / 64598 HGNCID:25078 Length:235 Species:Homo sapiens


Alignment Length:60 Identity:17/60 - (28%)
Similarity:31/60 - (51%) Gaps:7/60 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEICLQ-----PFVYDQQEK 85
            ::||.|.:...|.|::..|||.:|.|....|.:.|  .:.::|.::     |..||.|::
Human    54 LLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKP--QSCIDIVIRHVAPIPSHYDVQDR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 17/60 (28%)
MOSPD3NP_001035186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Motile_Sperm 41..>118 CDD:306983 17/60 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10809
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.