DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and Vapb

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_062780.2 Gene:Vapb / 56491 MGIID:1928744 Length:243 Species:Mus musculus


Alignment Length:263 Identity:100/263 - (38%)
Similarity:145/263 - (55%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            |::||:|||:|.||||..|.|.:.|.|.:...:.||:|||||:|||||||.|.|....|..|.:.
Mouse     8 LSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGVIDAGASLNVSVM 72

  Fly    75 LQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMPTAEANAENT 139
            ||||.||..||:||||||||:.||  .|.||:..:||:.:||.|||:||:||||:|...|...:.
Mouse    73 LQPFDYDPNEKSKHKFMVQSMFAP--PDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENAKPHDV 135

  Fly   140 SGGGAVGGGTGAAGGGSAGANTSSASAEALESKPKLSSEDKFKPSNLLETSESLDLLSGEIKALR 204
            .....:        ..||....:.|:|::|.| |...:|.|       :..|....|.||::.||
Mouse   136 EINKII--------PTSASKTEAPAAAKSLTS-PLDDTEVK-------KVMEECRRLQGEVQRLR 184

  Fly   205 ECNIELRRENLHLKDQITRFRSSPAVKQVNEPYAPVLA---EKQIPVFYIAVAIAAAIVSLLLGK 266
            |.:.:|:.|     |.:...::.|:    |.|.|.:.|   |:.:....:|:.:...||.:::||
Mouse   185 EESRQLKEE-----DGLRVRKAMPS----NSPVAALAATGKEEGLSARLLALVVLFFIVGVIIGK 240

  Fly   267 FFL 269
            ..|
Mouse   241 IAL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 56/104 (54%)
VapbNP_062780.2 Motile_Sperm 8..111 CDD:279029 56/104 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848687
Domainoid 1 1.000 111 1.000 Domainoid score I6243
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36163
Inparanoid 1 1.050 152 1.000 Inparanoid score I4332
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 1 1.000 - - otm42539
orthoMCL 1 0.900 - - OOG6_101143
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2279
SonicParanoid 1 1.000 - - X526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.