DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and vapal

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001002546.1 Gene:vapal / 436819 ZFINID:ZDB-GENE-040718-281 Length:246 Species:Danio rerio


Alignment Length:271 Identity:95/271 - (35%)
Similarity:138/271 - (50%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIP 65
            |||  .:..|.::|.::|:|.||||..|...:.|:|.|...:.||:|||||:|||||||.|.|.|
Zfish     1 MSK--LEQILVLDPPNDLKFKGPFTDVVTANLKLKNPSERKVCFKVKTTAPRRYCVRPNSGIIDP 63

  Fly    66 FRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMP 130
            ..:..:.:.||||.||..||:|||||||::.||  ..:||...:|||.:|::|||:||:||||:|
Zfish    64 GATLTISVMLQPFDYDPNEKSKHKFMVQTIFAP--PAVSDTEAMWKDAKPDELMDSKLRCVFELP 126

  Fly   131 TAEANAENTSGGGAVGGGTGAAGGGSAGANTSSASAEALESKPKLSSEDKFKPSNLLETSESLDL 195
            :.............|           ...|:|.|.. .|..||...:.|..:...:||..:.|..
Zfish   127 SENDKVNEVDSACKV-----------PVLNSSKADG-LLSVKPLSGAHDDSEMRRILEDRKRLQT 179

  Fly   196 LSGEIKALRECNIELRRENLHLKDQITRFRSSPAVKQVNEPYAPVLAEKQI--PVFYIAVAIAAA 258
               |:..|.:.|.:|:.|.|.|:      |..|....|:...:..:....:  .:..:.|.|||.
Zfish   180 ---ELSKLHDENRQLKDEGLRLR------RLQPRTDHVSSNSSTSVGRDSVSGSLPSLLVVIAAI 235

  Fly   259 IVSLLLGKFFL 269
            .:...||||.|
Zfish   236 FIGFFLGKFIL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 51/105 (49%)
vapalNP_001002546.1 Motile_Sperm 7..111 CDD:279029 51/105 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594209
Domainoid 1 1.000 116 1.000 Domainoid score I5915
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4213
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332028at2759
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 1 1.000 - - otm24830
orthoMCL 1 0.900 - - OOG6_101143
Panther 1 1.100 - - LDO PTHR10809
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.