DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and CG33523

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:150 Identity:39/150 - (26%)
Similarity:74/150 - (49%) Gaps:20/150 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            |.|.|:.   ||...::.....||:::.:...:.:||:||:|:::.|||..|.|.|.:...:.|.
  Fly   294 LHINPKD---FVNFNSKNAEATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATINIW 355

  Fly    75 LQPFVYDQQEKNKHKFMVQSVLAP-MDADLSDLNKLWK-------DLEPEQLM--------DAKL 123
            |:. .:...:.:|.||:|.:::|| .:...:|:.:||:       |:|..:|:        .|:|
  Fly   356 LKS-EHKLSDDSKDKFLVMAMVAPGGECGGADVTELWRSKSPTSADVEQHRLVCRFDENKSKAQL 419

  Fly   124 KCVFEMPTAEANAENTSGGG 143
            .|..:...|..:....||.|
  Fly   420 DCASKSSKASVDCSKKSGAG 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 30/112 (27%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044
Motile_Sperm 293..396 CDD:279029 29/105 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.