DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and Mospd1

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_038955682.1 Gene:Mospd1 / 317312 RGDID:1359486 Length:253 Species:Rattus norvegicus


Alignment Length:133 Identity:31/133 - (23%)
Similarity:54/133 - (40%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIP------ 65
            :||:.:.|. ||.|..........::||.|.....|.||:..|.|.:|.|....|.:.|      
  Rat    14 NLPVFVFPT-ELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVIDAAGAVKPQCCVDI 77

  Fly    66 -FRSTQVEIC----LQPFVYDQQEKNKHKFM-VQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLK 124
             .|...|..|    :..|.....|:::.|.: .:.|:|.:   |....:..|:.|.:::.:...:
  Rat    78 VIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVIATL---LPSAKEQQKEEEEKRIKEHLTE 139

  Fly   125 CVF 127
            .||
  Rat   140 SVF 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 27/117 (23%)
Mospd1XP_038955682.1 Motile_Sperm 16..113 CDD:395510 23/97 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.