DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and Mospd4

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001101711.1 Gene:Mospd4 / 317161 RGDID:1304785 Length:191 Species:Rattus norvegicus


Alignment Length:129 Identity:59/129 - (45%)
Similarity:80/129 - (62%) Gaps:2/129 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            |.::|..:|:|.||||......:.|||.|...:.||:|:|:|:|||||||.|.|.|..:..|...
  Rat    15 LVLDPPTDLKFKGPFTAVATAHLKLRNPSTRKVCFKVKSTSPRRYCVRPNSGVIEPGCTVTVAAM 79

  Fly    75 LQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMPTAEANAEN 138
            |||......::.|||||||:|.||  .|.|||..:|:.:.|.:|||:||:||||.||.....|:
  Rat    80 LQPSCCGPSQEVKHKFMVQTVFAP--PDTSDLEAVWRGVNPGELMDSKLRCVFEAPTESDKLED 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 46/104 (44%)
Mospd4NP_001101711.1 Motile_Sperm 14..108 CDD:395510 42/94 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352273
Domainoid 1 1.000 113 1.000 Domainoid score I5972
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4232
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332028at2759
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 1 1.000 - - otm44604
orthoMCL 1 0.900 - - OOG6_101143
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X526
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.