DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and Vapa

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_017172989.1 Gene:Vapa / 30960 MGIID:1353561 Length:290 Species:Mus musculus


Alignment Length:296 Identity:103/296 - (34%)
Similarity:150/296 - (50%) Gaps:56/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            |.::|..:|:|.||||..|.|.:.|:|.|...:.||:|||||:|||||||.|.|.|.....|.:.
Mouse    15 LVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSIVTVSVM 79

  Fly    75 LQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMPTAEANAENT 139
            ||||.||..||:|||||||::.||  .::||:..:||:.:|::|||:||:||||||    |..:.
Mouse    80 LQPFDYDPNEKSKHKFMVQTIFAP--PNISDMEAVWKEAKPDELMDSKLRCVFEMP----NENDK 138

  Fly   140 SGGGAVGGGTGAAGGGSAGANTSSASAEALESKPKLSSEDKFKPSNLLETSESLDLLSGE----- 199
            .|....|..:..|...|..:..::.::..|::.|:...|.|   .|.:|.|:::.|.:.:     
Mouse   139 LGKTPPGIASTVASLSSVSSAVATPASYHLKNDPRELKEVK---QNDMEPSKAVPLNASKQDGPL 200

  Fly   200 -------------IKALRECN------IELRRENLHLKDQITRFR---------SSPAVK---QV 233
                         .|.:.||.      ::|..||.||:|:..|.|         |:.||.   .|
Mouse   201 PKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNV 265

  Fly   234 NEPYAPVLAEKQIPVFYIAVAIAAAIVSLLLGKFFL 269
            ..|...:|           |.|||..:...||||.|
Mouse   266 TSPLPSLL-----------VVIAAIFIGFFLGKFIL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 52/104 (50%)
VapaXP_017172989.1 Motile_Sperm 14..118 CDD:334183 52/104 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848689
Domainoid 1 1.000 111 1.000 Domainoid score I6243
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4332
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1332028at2759
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 1 1.000 - - otm42539
orthoMCL 1 0.900 - - OOG6_101143
Panther 1 1.100 - - LDO PTHR10809
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2279
SonicParanoid 1 1.000 - - X526
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.