DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and ZC196.2

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_505251.2 Gene:ZC196.2 / 191101 WormBaseID:WBGene00022546 Length:345 Species:Caenorhabditis elegans


Alignment Length:263 Identity:51/263 - (19%)
Similarity:107/263 - (40%) Gaps:51/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEICLQPFVYDQQEKNKHKFMVQSVL 96
            :||:|.|..|:.||:||:.|..|..|||...:.|..:.|:.:..:...........:|..::|..
 Worm    30 VTLKNISEKPVCFKVKTSVPNMYVSRPNPDLLKPGEARQLSVKFRSSDKVSLNAKSYKLKIESCE 94

  Fly    97 APMDADLSDLNKLWKDLEPEQLMDAKLKCVF---------------EMPTAEANAENTSGGGAVG 146
            ...: |:.||...|..:..|:::..|...:.               |.....:..:|.|..|...
 Worm    95 FESE-DIDDLKSFWSSIPNEKILVHKSPIILGTGSSPDFRNDQIASESSRQSSPIQNVSDDGKSS 158

  Fly   147 GGTGAAGGGSAGANTSS-------------ASAEALESKPKLSSEDKFKPSNLLETS-ESLDLLS 197
            ..:.|........|:.|             .:.:|.::......:|:|:..|.||.. :.:|.:.
 Worm   159 HHSTAKQLQENNENSKSLKYTKQLVEVPLGENQQADQTGTTCDKKDEFQKKNQLEVEIKFVDKIH 223

  Fly   198 GEIKALRECNIELRRENLHLK---------DQITRF------RSSPA----VKQVNEPYAPVLAE 243
             |||:..|.:.||:.:.:.::         .::|:|      .:||.    |.::::.:: ::|:
 Worm   224 -EIKSQLEDSFELKLKEMEMRLEEKFEKRISRLTQFMETISLSNSPGNSRRVFELDDNFS-IVAK 286

  Fly   244 KQI 246
            |::
 Worm   287 KEL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 22/82 (27%)
ZC196.2NP_505251.2 Motile_Sperm 7..112 CDD:279029 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000705
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101143
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.