DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and F58E6.5

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_505516.1 Gene:F58E6.5 / 179368 WormBaseID:WBGene00010254 Length:304 Species:Caenorhabditis elegans


Alignment Length:253 Identity:49/253 - (19%)
Similarity:85/253 - (33%) Gaps:67/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIP 65
            ::|.:|:      |...:.|.....:..|:|..: |||...:..|.|.|.|..|..:|...| |.
 Worm     7 LTKVVFN------PSKSVTFAPVEKKQAVSIEVI-NNSTSDVAVKFKNTGPNVYKTQPPQAK-IG 63

  Fly    66 FRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVF--- 127
            ....:|..|:...:..::.|...:|.|..:.|..:.   .:.|.||:......|..|:..:|   
 Worm    64 VGEKKVFKCIFKGLPKEKCKTNDRFTVVYIAASKNV---VIEKAWKNAHKTCTMKHKIAILFQGV 125

  Fly   128 --------EMPT---------------AEANAENTSG----------------------GGAVGG 147
                    :.||               :::..|...|                      .|||.|
 Worm   126 NDQKENETQQPTNNDDDEDKDRQGQLRSKSKVETAKGKKATVVMFVRKEGDSVSDEEDDEGAVEG 190

  Fly   148 GTGAAGGGSAGANTSSASAEALESKPK------LSSEDKFKPSNLLETSESLDLLSGE 199
            .......|.|.:|.:...:|...::|.      ::|.|  .|.:.|.|:......||:
 Worm   191 AEHTNPAGVATSNEAGNMSELRTTRPAGAFTGVVASND--NPMSELRTTRPAGNFSGQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 24/105 (23%)
F58E6.5NP_505516.1 Motile_Sperm 9..110 CDD:279029 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10809
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.