DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and msp-64

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_495149.1 Gene:msp-64 / 173983 WormBaseID:WBGene00003457 Length:127 Species:Caenorhabditis elegans


Alignment Length:110 Identity:25/110 - (22%)
Similarity:48/110 - (43%) Gaps:1/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIP 65
            |::|:....:..:|..::.|..|:.......:.:.|:||..:.:.||||..||..|.|..|.:.|
 Worm     1 MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDP 65

  Fly    66 FRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLW 110
            ..:..:.:....|.:.|::.|..:..|:....| |.......:.|
 Worm    66 KEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTP-DGAAKQFRREW 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 23/102 (23%)
msp-64NP_495149.1 Motile_Sperm 9..114 CDD:395510 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.