DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and AgaP_AGAP005556

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_315559.4 Gene:AgaP_AGAP005556 / 1276239 VectorBaseID:AGAP005556 Length:533 Species:Anopheles gambiae


Alignment Length:196 Identity:52/196 - (26%)
Similarity:89/196 - (45%) Gaps:20/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEIC 74
            |.|:|::.:.| ......:|..:.:.|.....:.:|:|||||:::.|||:.|.:.|..|..:.:.
Mosquito   302 LRIKPQNTITF-SRLGNDLVGTVEITNVDTKDVSYKVKTTAPEKFRVRPSTGVLPPSASVNINVM 365

  Fly    75 LQPFVYDQQEK--NKHKFMVQSV--LAPMDADLSDLNKLWKDL--EPEQLMDAKLKCVFEMPTAE 133
            ||   ..||..  |:.||:|..:  ...:..:..||.:|||.:  :...:...:|||.......|
Mosquito   366 LQ---QGQQMHTINREKFLVMCIGLTDEISTNPQDLTELWKKISAKSSSVEQHRLKCALPANCDE 427

  Fly   134 ANAENTSGG-GAVGGGT---GAAGGGSAGANTSSASAEALESKPKLSSEDKFKPSNLLETSESLD 194
            :..|:..|| |.|..|.   |...|...|::.....|:      |..|..:...|:|.||:..|:
Mosquito   428 SGLESMFGGAGNVIAGPDQYGVMSGSFGGSSMMGMGAD------KQMSLLQQTISHLNETTHRLE 486

  Fly   195 L 195
            :
Mosquito   487 V 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 31/110 (28%)
AgaP_AGAP005556XP_315559.4 CRAL_TRIO 97..239 CDD:279044
Motile_Sperm 301..406 CDD:279029 31/107 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.