DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vap33 and pcdh9

DIOPT Version :9

Sequence 1:NP_570087.1 Gene:Vap33 / 31349 FlyBaseID:FBgn0029687 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_031752970.1 Gene:pcdh9 / 100489504 XenbaseID:XB-GENE-980876 Length:1295 Species:Xenopus tropicalis


Alignment Length:338 Identity:67/338 - (19%)
Similarity:115/338 - (34%) Gaps:97/338 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SLFDLP-----LT----IEPEHELRFVGPFTRPVVTIMTLRNNSALPL---------VFKIKTTA 50
            |.|||.     ||    .:.|.:.||:  ||      :|.|:|...||         |......:
 Frog   513 SFFDLDRKTGVLTASRVFDREEQERFI--FT------VTARDNGTPPLQSQAAVIVTVLDENDNS 569

  Fly    51 PK------RYCVRPNIGK--------------------IIPFRSTQVEICLQPF--------VYD 81
            ||      ::.|..|:.|                    .:...:......|.|:        .:|
 Frog   570 PKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNENFVLDPYSGLIKSNVSFD 634

  Fly    82 QQEKNKHKFMVQSV---------LAPMDADLSDLNKLWKD-----LEPEQLMDAKLKCVFEMP-- 130
            :::::.:.|.|::|         .|.:..::.|.|    |     :.|......||..:..:|  
 Frog   635 REQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDAN----DNSPVVISPPSNTSFKLVPLSAIPGS 695

  Fly   131 -TAEANAENT-SGGGAVGGGTGAAGGGSAGANTSSASAE-ALESKPKLSSEDKFKPSNLLETSES 192
             .||..|.:| :|..|....|..:|...........:.. .||.||  |:.|......::..|  
 Frog   696 VVAEVFAVDTDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKP--SAADVGLHRLVVNIS-- 756

  Fly   193 LDLLSGEIKALRECNI------ELRRENLHLKDQITRFRSSPAVKQVNEPYAPVLAEKQIPVFYI 251
             ||  |..|.|....:      |......::.|.|.|...:|..:.:.:...|...|..:.:. |
 Frog   757 -DL--GYPKPLHTLVLVFLYVNETAGNASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIM-I 817

  Fly   252 AVAIAAAIVSLLL 264
            |:...|.:|.:::
 Frog   818 AIVAGAMVVIVVI 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vap33NP_570087.1 Motile_Sperm 9..115 CDD:279029 28/171 (16%)
pcdh9XP_031752970.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165176199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.