DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and rem2

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_001116518.1 Gene:rem2 / 798285 ZFINID:ZDB-GENE-081110-1 Length:306 Species:Danio rerio


Alignment Length:246 Identity:61/246 - (24%)
Similarity:104/246 - (42%) Gaps:67/246 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1009 KIAMLGASGVGKTTLTYQFTTSDYICAYDLS------------LDDDYGQKTVSVLVDNIETDLE 1061
            :|.:||.:||||::|.        :|...||            .|:.|.::   |.||:.::.:.
Zfish    76 RIVLLGQNGVGKSSLA--------LCLAGLSDRSLSIDSETQAADEGYPRR---VTVDDEDSSIL 129

  Fly  1062 IIDHPACEMSTEAFCATYNIDLFVVVYSVIDRNTFAAAERVLQYLKENEMLLSRGAILVANKTDL 1126
            :.|:...|:|      |...::.::|:|:.||.:|....::...|:|:  |.....|||.||:||
Zfish   130 VYDNWKQELS------TLQCEVCILVFSLTDRRSFHRIAQLRLLLRES--LPHTPIILVGNKSDL 186

  Fly  1127 QRHRVVTRQMGRKVAKEIACKFIETSSGLDHNVDELLVGIVAQVK-------------------- 1171
            .|.|.::.:.....|....|.::|.|..|||..::||...|...:                    
Zfish   187 VRSREISTEEAHSSAMMFGCLYLELSVSLDHRTNDLLEAAVRAARGHSLGPGWTEGSPSAARRES 251

  Fly  1172 LNPQRLRLLTELELQRLNL----------QSTIQKHRGMHLQTRRMVRQMS 1212
            |..:..|.|:.| :.|.:|          ...:.:|||     .||:||.|
Zfish   252 LTSRAKRFLSGL-VPRSHLGRERDREPGRDRDLSRHRG-----SRMLRQKS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 48/197 (24%)
small_GTPase 1008..1171 CDD:197466 47/173 (27%)
rem2NP_001116518.1 P-loop_NTPase 75..305 CDD:304359 61/246 (25%)
Ras 76..231 CDD:278499 47/173 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.