DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and RRAD

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_001122322.1 Gene:RRAD / 6236 HGNCID:10446 Length:308 Species:Homo sapiens


Alignment Length:334 Identity:86/334 - (25%)
Similarity:119/334 - (35%) Gaps:121/334 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   875 GVGESSGASTSGTAIAELASSVVLATQSGKPMTERQRLRTS------------SMPAESRRPRLA 927
            |.|..:|.|..|                |:   ||:|.|.|            |||.:.|     
Human     5 GGGSGAGGSRGG----------------GQ---ERERRRGSTPWGPAPPLHRRSMPVDER----- 45

  Fly   928 EMRRSAIHAGDPDMTYYRLRSFSITSHGICNLGDSLRSRRSRSINSVTSTGTSNSG------VDR 986
                                              .|::..:....:..:.||...|      .|.
Human    46 ----------------------------------DLQAALTPGALTAAAAGTGTQGPRLDWPEDS 76

  Fly   987 HNSNASGASGEVIDGDPNVPAYKIAMLGASGVGKTTLTYQFTTSDYICAYDLSLDDDYGQKTV-- 1049
            .:|.:||.|    |.|.:|  ||:.:|||.||||:.|...|.          .::|....:..  
Human    77 EDSLSSGGS----DSDESV--YKVLLLGAPGVGKSALARIFG----------GVEDGPEAEAAGH 125

  Fly  1050 ----SVLVDNIETDLEIID------------HPACEMSTEAFCATYNIDLFVVVYSVIDRNTFAA 1098
                |::||..|..|.:.|            |          |.... |.:|:||||.|:.:|..
Human   126 TYDRSIVVDGEEASLMVYDIWEQDGGRWLPGH----------CMAMG-DAYVIVYSVTDKGSFEK 179

  Fly  1099 AERVLQYLKENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIACKFIETSSGLDHNVDELL 1163
            |..:...|:..........|||.||:||.|.|.|:...||..|....|||||||:.|.|||..|.
Human   180 ASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALF 244

  Fly  1164 VGIVAQVKL 1172
            .|:|.|::|
Human   245 EGVVRQIRL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 59/183 (32%)
small_GTPase 1008..1171 CDD:197466 58/180 (32%)
RRADNP_001122322.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 25/144 (17%)
RGK 92..308 CDD:206715 59/183 (32%)
RAS 92..252 CDD:214541 58/180 (32%)
Calmodulin-binding 278..297
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.