DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and Rrad

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_062636.2 Gene:Rrad / 56437 MGIID:1930943 Length:307 Species:Mus musculus


Alignment Length:216 Identity:69/216 - (31%)
Similarity:97/216 - (44%) Gaps:35/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   973 SVTSTGTSNSG--VD----RHNSNASGASGEVIDGDPNVPAYKIAMLGASGVGKTTLTYQFTTSD 1031
            :.|:.||...|  :|    ..:|.:||.||.. :|     .||:.:|||.||||:.|...|.   
Mouse    56 ATTAAGTRTQGQRLDWPEGSSDSLSSGGSGSE-EG-----VYKVLLLGAPGVGKSALARIFG--- 111

  Fly  1032 YICAYDLSLDDDYGQKTV------SVLVDNIETDLEIID----HPACEMSTEAFCATYNIDLFVV 1086
                   .::|....:..      |:.||..|..|.:.|    ...|.:  ...|.... |.:|:
Mouse   112 -------GIEDGPEAEAAGHTYDRSITVDGEEASLLVYDIWEQDGGCWL--PGHCMAMG-DAYVI 166

  Fly  1087 VYSVIDRNTFAAAERVLQYLKENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIACKFIET 1151
            |||:.|:.:|..|..:...|:..........|||.||:||.|.|.|:...||..|....||||||
Mouse   167 VYSITDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIET 231

  Fly  1152 SSGLDHNVDELLVGIVAQVKL 1172
            |:.|.|||..|..|:|.|::|
Mouse   232 SAALHHNVQALFEGVVRQIRL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 58/175 (33%)
small_GTPase 1008..1171 CDD:197466 57/172 (33%)
RradNP_062636.2 RGK 91..307 CDD:206715 58/175 (33%)
Calmodulin-binding. /evidence=ECO:0000250 277..296
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8675
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.