DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and gem

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_001039314.1 Gene:gem / 560566 ZFINID:ZDB-GENE-060825-251 Length:291 Species:Danio rerio


Alignment Length:306 Identity:87/306 - (28%)
Similarity:142/306 - (46%) Gaps:41/306 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   926 LAEMRRSAIHAGDPDMTYYRLRSFSIT-SHGICNLGDSL-RSRRSRSINSVTSTGTSNSGVDRHN 988
            ||.:||.:|.      ..:.|..:||. :.|...|.|:. ||..|.|.:|..|:.:|:|.:.  .
Zfish     4 LASVRRHSIR------VQHHLHRWSICGTDGGQLLNDAFPRSDISMSRSSSCSSASSDSALS--T 60

  Fly   989 SNASGASGEVIDGDPNVPAYKIAMLGASGVGKTTLTYQFTTSDYICAYDLSLDDDYG----QKTV 1049
            .:|:.||         |..:.:.:||.:||||:.|...|..:......:..|   ||    ::|:
Zfish    61 ESATPAS---------VGPFTVVLLGDNGVGKSALASIFAGASDSMGSECEL---YGGEIFEQTI 113

  Fly  1050 SVLVDNIETDLEIID--HPACEMS-TEAFCATYNIDLFVVVYSVIDRNTFAAAERVLQYLKENEM 1111
            :  ||.....:.::|  ....|.| |:..|.... |.|::||::.||::|..|..:...|:....
Zfish   114 T--VDGERASVTLLDTWDSQDEGSWTQQRCLQTG-DAFIIVYAITDRSSFLRASDLRVQLRRERE 175

  Fly  1112 LLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIACKFIETSSGLDHNVDELLVGIVAQVKLNPQR 1176
            :.....|||.||.||.|.|.|:...||..|....|||||||:.:.|||..|..||:.|::|... 
Zfish   176 VDRTPIILVGNKCDLVRCREVSISEGRSSAAVFDCKFIETSAAMQHNVWPLFEGIIRQLRLRRD- 239

  Fly  1177 LRLLTELELQRLNLQSTIQKHR-GMHLQTRRMVRQMSVCQGDEEIF 1221
                   .::.|:..|::||.| .:..:.:|.:.:|...:..:..|
Zfish   240 -------SMETLSSHSSLQKRRESLPKKAKRFINRMVAKKNKQAAF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 56/173 (32%)
small_GTPase 1008..1171 CDD:197466 55/169 (33%)
gemNP_001039314.1 RGK 71..291 CDD:206715 64/222 (29%)
small_GTPase 73..237 CDD:197466 55/169 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.