DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and rrad

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_001016726.1 Gene:rrad / 549480 XenbaseID:XB-GENE-491671 Length:303 Species:Xenopus tropicalis


Alignment Length:334 Identity:87/334 - (26%)
Similarity:132/334 - (39%) Gaps:92/334 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   905 PMTERQRLRTSSMPAESRRPRLAEMRRSAIHAGDPDMTYYRLRSFSITSHGICNLGDSLRSRRSR 969
            |.:..|:|...|||.:.:.          :|...|                            :.
 Frog    20 PFSMHQQLHRRSMPVDDKE----------LHGKTP----------------------------AS 46

  Fly   970 SINSVTSTGTSNSGVDRHNSNASGASGEVI----DGDPNVPAYKIAMLGASGVGKTTLTYQFTTS 1030
            .::|:....:.|...:...|.||.:|..||    |.:.:|  ||:.:||..||||::|...|...
 Frog    47 QLSSLVRCPSYNPSDEHRESWASDSSDSVISSGSDSEDHV--YKVILLGEHGVGKSSLARIFGGV 109

  Fly  1031 DYICAYDLSLDDDYGQK-TVSVLVDNIETDLEIID----------HPAC-EMSTEAFCATYNIDL 1083
            :     ||...::.|.. ..|::||..|..|.:.|          |..| :|.          |.
 Frog   110 E-----DLHDVEEAGNTYDRSIVVDGEEACLLVFDIWEQDDNHWLHNQCMKMG----------DA 159

  Fly  1084 FVVVYSVIDRNTFAAAERVLQYLKENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIACKF 1148
            :|:||||.|:.:|..|..:...|:..........|||.||:||.|.|.|:.:.||..|....|||
 Frog   160 YVIVYSVTDKASFEKASELRIQLRRARQSEDIPIILVGNKSDLVRSREVSVEEGRACAVVFDCKF 224

  Fly  1149 IETSSGLDHNVDELLVGIVAQVKL-------NPQRL--------------RLLTELELQRLNLQS 1192
            ||||:.|.|||.:|..|||.|::|       |.:|:              |.|.::..:.....:
 Frog   225 IETSASLHHNVKDLFEGIVRQIRLRKDSKEDNARRMASSKRRESIGKKAKRFLGKIVAKNNKKMA 289

  Fly  1193 TIQKHRGMH 1201
            ..||.:..|
 Frog   290 FKQKSKSCH 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 63/185 (34%)
small_GTPase 1008..1171 CDD:197466 61/174 (35%)
rradNP_001016726.1 RGK 87..303 CDD:206715 69/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.