DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and rem1

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_957468.1 Gene:rem1 / 394149 ZFINID:ZDB-GENE-040317-1 Length:298 Species:Danio rerio


Alignment Length:375 Identity:92/375 - (24%)
Similarity:150/375 - (40%) Gaps:110/375 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   844 NQQKQQQQLLQLQLQQEQQHLPTHLPMKRERGVGESSGASTSGTAIAELASSVVLATQSGKPMTE 908
            |.||:.::.|       ::...|.:|..|:.|.|:..                        |.| 
Zfish     4 NTQKEGKEPL-------RRRASTPIPSSRQAGRGDRD------------------------PST- 36

  Fly   909 RQRLRTSSMPAESRRPRLAEMRRSAIHAGDPDMTYYRLRSFSITSHGICNLGDSLRSRRSRSINS 973
                       :...|.||:  .::.|.||                      .|:.||.:.|.:|
Zfish    37 -----------DPYHPPLAQ--SASYHPGD----------------------KSIHSRANWSSDS 66

  Fly   974 VTSTGTSNSGVDRHNSNASGASGEVIDGDPNVPAYKIAMLGASGVGKTTLTYQFTTSDYICAYDL 1038
                          .|::||:  |.:        |::.:||..||||::|...|.......|:..
Zfish    67 --------------ESDSSGS--ECL--------YRVVLLGDHGVGKSSLANIFAGIQEKDAHKH 107

  Fly  1039 SLDDDY-------GQKTVSVLVDNIETDLEIIDHPACEMSTEAFCATYNIDLFVVVYSVIDRNTF 1096
            ..:|.|       |:.|..|::|..|||.:..|    |...:.:|.... :.:::|||:.||::|
Zfish   108 IGEDAYERTLMVDGEDTTLVVMDPWETDKQEDD----EKFLQDYCMQVG-NAYIIVYSITDRSSF 167

  Fly  1097 AAAERVLQYLKENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIACKFIETSSGLDHNVDE 1161
            .:|..:...|:......:...|||.||:||.|.|.|..:.||..|....|||||||:.|.|||.|
Zfish   168 ESASELRIQLRRIRQAENIPIILVGNKSDLVRSREVAVEEGRACAVMFDCKFIETSASLHHNVHE 232

  Fly  1162 LLVGIVAQVKLNPQRLRLLTELELQRLNLQSTIQKHRGMHLQTRRMVRQM 1211
            |..|.|.|::|.    |...|:..:|   :|..::...:..:.||.:.::
Zfish   233 LFEGTVRQIRLR----RDSKEINERR---RSVYKRKESITKKARRFLDRL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 60/173 (35%)
small_GTPase 1008..1171 CDD:197466 59/169 (35%)
rem1NP_957468.1 RGK 77..298 CDD:206715 66/211 (31%)
small_GTPase 77..244 CDD:197466 59/171 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.