DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and Rem1

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_001020924.1 Gene:Rem1 / 366232 RGDID:1306560 Length:297 Species:Rattus norvegicus


Alignment Length:303 Identity:83/303 - (27%)
Similarity:125/303 - (41%) Gaps:79/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   896 VVLATQSGKPMTERQRLRT---------------SSMPAESRRPRLAEMRRSAIHAGDPDMTYYR 945
            :.|.||.....|.|:|..|               ::.||:|:.|||.:                 
  Rat     1 MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPPAQSQHPRLGQ----------------- 48

  Fly   946 LRSFSITSHGICNLGDSLRSRRSRSIN-SVTSTGTSNSGVDRHNSNASGASGEVIDGDPNVPAYK 1009
                                  |.|:| .:.....:..|....:|::.| |.|.:        |:
  Rat    49 ----------------------SASLNPPIRKPSPAQDGWSSESSDSEG-SWEAL--------YR 82

  Fly  1010 IAMLGASGVGKTTLTYQFTTSDYICAYDLSLDDDYG---QKTVSVLVDNIETDLEIIDHPACEMS 1071
            :.:||..|||||:|...|....     :..|.:..|   ::|:|  ||..:|.|.::|....|..
  Rat    83 VVLLGDPGVGKTSLASLFAEKQ-----ERDLHEQLGGVYERTLS--VDGEDTTLVVMDTWEAEKL 140

  Fly  1072 TEAF----CATYNIDLFVVVYSVIDRNTFAAAERVLQYLKENEMLLSRGAILVANKTDLQRHRVV 1132
            .|::    |.... ..:|:|||:.||::|.:|..:...|:..........|||.||.||.|.|.|
  Rat   141 DESWSQESCLQAG-SAYVIVYSIADRSSFESASELRIQLRRTHQAAHVPIILVGNKADLARCREV 204

  Fly  1133 TRQMGRKVAKEIACKFIETSSGLDHNVDELLVGIVAQVKLNPQ 1175
            :.:.||..|....|||||||:.|.|||.||..|:|.|::|..|
  Rat   205 SVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVRQLRLRRQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 61/173 (35%)
small_GTPase 1008..1171 CDD:197466 60/169 (36%)
Rem1NP_001020924.1 RGK 81..297 CDD:206715 62/175 (35%)
small_GTPase 81..245 CDD:197466 60/171 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8910
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.