DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and rrad

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:XP_021333082.1 Gene:rrad / 327396 ZFINID:ZDB-GENE-030131-5607 Length:304 Species:Danio rerio


Alignment Length:311 Identity:90/311 - (28%)
Similarity:128/311 - (41%) Gaps:86/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   958 NLGDSLRS------------------RRS-----RSINSVTST------GTSNSGVDRHNSNASG 993
            |.||.||:                  |||     |.:.|:.:.      |......|| ||..|.
Zfish     8 NKGDKLRNMDKRRGSMPFPLHLQTLHRRSMPVDDRELRSMPAAQPSELPGLMRFNADR-NSCVSD 71

  Fly   994 ASGEVI----DGDPNVPAYKIAMLGASGVGKTTLTYQF----TTSDYIC-----AYDLSLDDDYG 1045
            :|..||    |.|..|  ||:.:||..||||::|...|    .::|  |     .||.||     
Zfish    72 SSDSVISSGSDSDGQV--YKVVLLGEHGVGKSSLARIFGGVEDSND--CEETGNTYDRSL----- 127

  Fly  1046 QKTVSVLVDNIETDLEIIDHPACEMSTEAF----CATYNIDLFVVVYSVIDRNTFAAAERVLQYL 1106
                  :||:.||.:.:.|  ..|.....:    |.... |.:::||||.|:::|..|..:...|
Zfish   128 ------VVDDEETSILLYD--IWEQDNSQWLQDQCMRMG-DAYIIVYSVTDKSSFEKASELRIQL 183

  Fly  1107 KENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIACKFIETSSGLDHNVDELLVGIVAQVK 1171
            :......:...|||.||:||.|.|.|:...|...|....|||||||:.|.|||.:|..|||.|::
Zfish   184 RRARQSENIPIILVGNKSDLVRSREVSMDEGSACAVVFDCKFIETSASLHHNVRDLFEGIVRQIR 248

  Fly  1172 L-------NPQRL--------------RLLTELELQRLNLQSTIQKHRGMH 1201
            |       |.:|:              |.|..:..::....:..||.:..|
Zfish   249 LRKDSKEENARRMANCKRRESISKKAKRFLGRMVARKNKKMAFRQKSKSCH 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 62/186 (33%)
small_GTPase 1008..1171 CDD:197466 60/175 (34%)
rradXP_021333082.1 RGK 88..304 CDD:206715 68/228 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.