DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and GEM

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_005252.1 Gene:GEM / 2669 HGNCID:4234 Length:296 Species:Homo sapiens


Alignment Length:282 Identity:85/282 - (30%)
Similarity:119/282 - (42%) Gaps:71/282 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   916 SMPAESRRPRLAEMRRSAIHAGDPDMTYYRLRSFSITSHGICNLGDSLRSRRSRSINSVTSTGTS 980
            |:||:.|...:.:         :|....:|.| .|.|....|        |||.|.:|..|..:|
Human    23 SIPADGRHLMVQK---------EPHQYSHRNR-HSATPEDHC--------RRSWSSDSTDSVISS 69

  Fly   981 NSGVDRHNSNASGASGEVIDGDPNVPAYKIAMLGASGVGKTTLTYQFT----TSDYIC------A 1035
            .||    |:                 .|::.::|..||||:||...|.    :.|..|      .
Human    70 ESG----NT-----------------YYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDT 113

  Fly  1036 YDLSLDDDYGQKTVSVLVDNIETDLE---IIDHPACEMSTEAFCATYNIDLFVVVYSVIDRNTFA 1097
            |:.:|..| |:....:|:|..|...|   :.||          |.... |.:::|||:.||.:|.
Human   114 YERTLMVD-GESATIILLDMWENKGENEWLHDH----------CMQVG-DAYLIVYSITDRASFE 166

  Fly  1098 AAERVLQYLKENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIACKFIETSSGLDHNVDEL 1162
            .|..:...|:..........|||.||:||.|.|.|:...||..|....|||||||:.:.|||.||
Human   167 KASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKEL 231

  Fly  1163 LVGIVAQVKL-------NPQRL 1177
            ..|||.||:|       |.:||
Human   232 FEGIVRQVRLRRDSKEKNERRL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 63/186 (34%)
small_GTPase 1008..1171 CDD:197466 60/175 (34%)
GEMNP_005252.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 12/39 (31%)
RGK 76..296 CDD:206715 65/190 (34%)
Calmodulin-binding. /evidence=ECO:0000250 266..285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.