DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and Rem1

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_033073.1 Gene:Rem1 / 19700 MGIID:1097696 Length:297 Species:Mus musculus


Alignment Length:237 Identity:77/237 - (32%)
Similarity:114/237 - (48%) Gaps:24/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   951 ITSHG-----ICNLGDSLRSRRSRSINSVTSTGTSNSGVDRHNSNASGASGEVIDGDPNVPA-YK 1009
            ::|.|     :|. ..|..|:..|...||    :.|..|.:.:....|.|.|..|.:.:..| |:
Mouse    23 LSSRGHQPGRLCT-APSAPSQHPRLGQSV----SLNPPVRKPSPAQDGWSSESSDSEGSWEALYR 82

  Fly  1010 IAMLGASGVGKTTLTYQFTTSDYICAYDLSLDDDYG---QKTVSVLVDNIETDLEIIDHPACEMS 1071
            :.:||..|||||:|...|....     |....:..|   ::|:|  ||..:|.|.::|....|..
Mouse    83 VVLLGDPGVGKTSLASLFAEKQ-----DRDPHEQLGGVYERTLS--VDGEDTTLVVMDTWEAEKL 140

  Fly  1072 TEAFCATYNI---DLFVVVYSVIDRNTFAAAERVLQYLKENEMLLSRGAILVANKTDLQRHRVVT 1133
            .|::|....:   ..:|:|||:.||::|.:|..:...|:..........|||.||.||.|.|.|:
Mouse   141 DESWCQESCLQAGSAYVIVYSIADRSSFESASELRIQLRRTHQANHVPIILVGNKADLARCREVS 205

  Fly  1134 RQMGRKVAKEIACKFIETSSGLDHNVDELLVGIVAQVKLNPQ 1175
            .:.||..|....|||||||:.|.|||.||..|:|.|::|..|
Mouse   206 VEEGRACAVVFDCKFIETSATLQHNVTELFEGVVRQLRLRRQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 61/172 (35%)
small_GTPase 1008..1171 CDD:197466 60/168 (36%)
Rem1NP_033073.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73 13/54 (24%)
RGK 81..297 CDD:206715 62/174 (36%)
small_GTPase 81..245 CDD:197466 60/170 (35%)
Calmodulin-binding 267..286
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8675
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.