DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and REM2

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:XP_016876547.1 Gene:REM2 / 161253 HGNCID:20248 Length:373 Species:Homo sapiens


Alignment Length:368 Identity:98/368 - (26%)
Similarity:150/368 - (40%) Gaps:94/368 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   827 GNGDSTDSPSPVSMIPSNQQKQQQQLLQLQLQQEQQHLPTHLPMKRERGVGESSGASTSGTAIAE 891
            |||.......|:.:        :|..|.|      .|:..|:|:.          ||.|..:...
Human    25 GNGHQVGVAGPLIL--------EQPGLSL------LHMVEHIPLI----------ASFSLPSHFI 65

  Fly   892 LASSVVLATQSGKPMTERQRLRTSSMPAESRRPRLAEMRRSAIHAGDPDMTYYRLRSFSITSHGI 956
            |.:...|..:|.|.:.|..|   |.:|:....||    ||     |...:.|         .|.:
Human    66 LEADATLLKKSEKLLAELDR---SGLPSAPGAPR----RR-----GSMPVPY---------KHQL 109

  Fly   957 CNLGDSLRSRRSRSINSVT-STGTSNSGVDRHNSNASGASGEVI----DGDPNVPAYKIAMLGAS 1016
                     ||:::::.:. ....|:||     |:.|..|||..    ||     .:|:.::|.|
Human   110 ---------RRAQAVDELDWPPQASSSG-----SSDSLGSGEAAPAQKDG-----IFKVMLVGES 155

  Fly  1017 GVGKTTL--TYQFTTSDYICAYDLSLDDDYGQKTVSVLVDNIETDLEIID-----------HPAC 1068
            ||||:||  |:.....|.....:...:|.|.::   ::||..|..|.:.|           ...|
Human   156 GVGKSTLAGTFGGLQGDSAHEPENPAEDTYERR---IMVDKEEVTLVVYDIWEQGDAGGWLRDHC 217

  Fly  1069 EMSTEAFCATYNIDLFVVVYSVIDRNTFAAAERVLQYLKENEMLLSRGAILVANKTDLQRHRVVT 1133
            ..:.:|         |::|:||.||.:|:.....|..|:..........|||.||:||.|.|.|:
Human   218 LQTGDA---------FLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVS 273

  Fly  1134 RQMGRKVAKEIACKFIETSSGLDHNVDELLVGIVAQVKLNPQR 1176
            .:.||.:|..::||.||||:.|.||..||..|.|.|::|...|
Human   274 LEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRRGR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 57/179 (32%)
small_GTPase 1008..1171 CDD:197466 56/175 (32%)
REM2XP_016876547.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.