DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and Gem

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_034406.2 Gene:Gem / 14579 MGIID:99844 Length:295 Species:Mus musculus


Alignment Length:294 Identity:85/294 - (28%)
Similarity:123/294 - (41%) Gaps:78/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   906 MTERQRLRTSSMPAESRRPRLAEMRRSAIHAGDPDMTYYRLRSFSITSHGICNLGDSLRSRRSRS 970
            |..:||.   |:||::|...:.:         ||..               ||    ||:|.|  
Mouse    15 MQPQQRW---SIPADARHLMVQK---------DPHP---------------CN----LRNRHS-- 46

  Fly   971 INSVTSTGTSNSGVDRH--NSNASGASGEVIDGDPNVPAYKIAMLGASGVGKTTLTYQFT----T 1029
                       :..:.|  .|.:|.::..||..:.....|::.::|..||||:||...|.    :
Mouse    47 -----------TAPEEHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDS 100

  Fly  1030 SDYIC------AYDLSLDDDYGQKTVSVLVDNIETDLE---IIDHPACEMSTEAFCATYNIDLFV 1085
            .|..|      .|:.:|..| |:....:|:|..|...|   :.||          |.... |.::
Mouse   101 MDSDCEVLGEDTYERTLVVD-GESATIILLDMWENKGENEWLHDH----------CMQVG-DAYL 153

  Fly  1086 VVYSVIDRNTFAAAERVLQYLKENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIACKFIE 1150
            :|||:.||.:|..|..:...|:..........|||.||:||.|.|.|:...||..|....|||||
Mouse   154 IVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIE 218

  Fly  1151 TSSGLDHNVDELLVGIVAQVKL-------NPQRL 1177
            ||:.:.|||.||..|||.||:|       |.:||
Mouse   219 TSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 63/186 (34%)
small_GTPase 1008..1171 CDD:197466 60/175 (34%)
GemNP_034406.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..64 9/41 (22%)
RGK 75..295 CDD:206715 65/190 (34%)
small_GTPase 75..241 CDD:197466 61/177 (34%)
Calmodulin-binding 265..284
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8675
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.