DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaAC39-1 and atp6v0d1

DIOPT Version :9

Sequence 1:NP_570080.1 Gene:VhaAC39-1 / 31342 FlyBaseID:FBgn0285910 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001017310.1 Gene:atp6v0d1 / 550064 XenbaseID:XB-GENE-989918 Length:351 Species:Xenopus tropicalis


Alignment Length:347 Identity:282/347 - (81%)
Similarity:317/347 - (91%) Gaps:0/347 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGFMFNIDNGYLEGLCRGFKCGILKQADYLNLVQCETLEDLKLHLQGTDYGSFLANEPSPLSVSV 68
            |...||:|:||||||.||||.|||.|.|||||||||||||||||||.||||:|||||.|||:|||
 Frog     5 SELYFNVDSGYLEGLVRGFKAGILSQGDYLNLVQCETLEDLKLHLQSTDYGTFLANEASPLAVSV 69

  Fly    69 IDDKLREKLVIEFQHMRNHAVEPLSNFLDFITYGYMIDNIILLITGTLHQRPISELIPKCHPLGS 133
            |||||:||:|:||:||||.:.|||::|:|||||.|||||:|||||||||||.||||:||||||||
 Frog    70 IDDKLKEKMVVEFRHMRNQSYEPLASFMDFITYSYMIDNVILLITGTLHQRSISELVPKCHPLGS 134

  Fly   134 FEQMEAIHVASTPAELYNAVLVDTPLAPFFVDCISEQDLDEMNIEIIRNTLYKAYLEAFYNFCKN 198
            ||||||:::|.||||||||:|||||||.||.||||||||||||||||||||||||||:||.||.:
 Frog   135 FEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCDS 199

  Fly   199 MGGATADVMCEILAFEADRRAIIITINSFGTELSKDDRAKLYPNCGKMYPDGLAALARADDYEQV 263
            :||.|||.||.||.|||||||.|||||||||||||:|||||:|:|||:||:|||.||||||||||
 Frog   200 LGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGKLYPEGLAQLARADDYEQV 264

  Fly   264 KTVAEYYAEYAALFDGSGNNPGDKTLEDKFFEHEVKLDVYAFLQQFHFGVFYAYLKLKEQECRNI 328
            ||||:||.||..||:|:|||||||||||:||||||||:..|||.|||||||||::||||||||||
 Frog   265 KTVADYYPEYKLLFEGAGNNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNI 329

  Fly   329 VWIAECVAQKHRAKIDNYIPIF 350
            ||||||:||:||||||||||||
 Frog   330 VWIAECIAQRHRAKIDNYIPIF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaAC39-1NP_570080.1 vATP-synt_AC39 15..343 CDD:396538 267/327 (82%)
atp6v0d1NP_001017310.1 vATP-synt_AC39 16..344 CDD:376708 267/327 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 577 1.000 Domainoid score I217
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3444
Inparanoid 1 1.050 599 1.000 Inparanoid score I948
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343609at33208
OrthoFinder 1 1.000 - - FOG0001865
OrthoInspector 1 1.000 - - oto104067
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1221
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.