DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaAC39-1 and Atp6v0d2

DIOPT Version :9

Sequence 1:NP_570080.1 Gene:VhaAC39-1 / 31342 FlyBaseID:FBgn0285910 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001011972.1 Gene:Atp6v0d2 / 297932 RGDID:1306900 Length:350 Species:Rattus norvegicus


Alignment Length:349 Identity:217/349 - (62%)
Similarity:282/349 - (80%) Gaps:1/349 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSSGFMFNIDNGYLEGLCRGFKCGILKQADYLNLVQCETLEDLKLHLQGTDYGSFLANEPSPLS 65
            :.::...||:|:||||||.||.|..:|.|.||:||||||||||||:|||.||||:|||:|.:||:
  Rat     2 LETAELYFNVDHGYLEGLVRGCKASLLTQQDYVNLVQCETLEDLKIHLQTTDYGNFLAHETNPLT 66

  Fly    66 VSVIDDKLREKLVIEFQHMRNHAVEPLSNFLDFITYGYMIDNIILLITGTLHQRPISELIPKCHP 130
            ||.||.::|:||..||.:.|||::||||.|..::|..|||||||||:.|.|.::.:.|::.||||
  Rat    67 VSKIDTEMRKKLCREFDYFRNHSLEPLSTFFTYMTCSYMIDNIILLMNGALQKKSVKEVLAKCHP 131

  Fly   131 LGSFEQMEAIHVASTPAELYNAVLVDTPLAPFFVDCISEQDLDEMNIEIIRNTLYKAYLEAFYNF 195
            ||.|.:|||:::|.:.:||:.||||:|||||||.||:||..|||:|||::||.|||:||||||.|
  Rat   132 LGRFTEMEAVNIAESASELFKAVLVETPLAPFFQDCMSENTLDELNIELLRNKLYKSYLEAFYKF 196

  Fly   196 CKNMGGATADVMCEILAFEADRRAIIITINSFGTELSKDDRAKLYPNCGKMYPDGLAALARADDY 260
            ||:.|..||:|||.||.|||||||:|||:|||||||||:||..|:|.|||:||:||..||:|:|:
  Rat   197 CKDHGDVTAEVMCPILEFEADRRALIITLNSFGTELSKEDRETLFPTCGKLYPEGLRLLAQAEDF 261

  Fly   261 EQVKTVAEYYAEYAALFDGSGNNPGDKTLEDKFFEHEVKLDVYAFLQQFHFGVFYAYLKLKEQEC 325
            |.:|.||:.|..|..|||..|.: |.|||||.|:|.||:::|.||.:|||:||||||:||||||.
  Rat   262 EHMKRVADNYGVYKPLFDAVGGS-GGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEM 325

  Fly   326 RNIVWIAECVAQKHRAKIDNYIPI 349
            |||||||||::|:||.||::||||
  Rat   326 RNIVWIAECISQRHRTKINSYIPI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaAC39-1NP_570080.1 vATP-synt_AC39 15..343 CDD:396538 206/327 (63%)
Atp6v0d2NP_001011972.1 vATP-synt_AC39 16..338 CDD:396538 203/322 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54196
OrthoDB 1 1.010 - - D343609at33208
OrthoFinder 1 1.000 - - FOG0001865
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101546
Panther 1 1.100 - - O PTHR11028
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1221
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.