DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2930 and AT5G11570

DIOPT Version :9

Sequence 1:NP_001284845.1 Gene:CG2930 / 31341 FlyBaseID:FBgn0028491 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_196718.1 Gene:AT5G11570 / 831029 AraportID:AT5G11570 Length:481 Species:Arabidopsis thaliana


Alignment Length:495 Identity:114/495 - (23%)
Similarity:195/495 - (39%) Gaps:104/495 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 FIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFK 199
            ||::::..|:..|:|:...::|:|:...|.....|..:..:::....|..:.||.|:||:.|:|.
plant    22 FILASQALEKLAYFGLVPNMILFLTVEYGMGTAEAANILFLWSAATNFFPLVGAFIADSYTGRFP 86

  Fly   200 TILYLSLVYICGSVLLTLGAI------------GPLNLPMETFTMLGLALIALGSGGIKPCVSAF 252
            .|.:.|.:.:.|.|||.|..|            .|..|..........||.|:|:||::....||
plant    87 LIGFGSSISLTGMVLLWLTTIIRPECDKLTNVCQPTTLLKSVLLYSFFALTAIGAGGVRSSCLAF 151

  Fly   253 GGDQFKVPEQVKQIT-----SFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPA 312
            ..||.: |.|..::|     :.|:.:|||:.....:|.::...::....       :.:.|||..
plant   152 AADQLQ-PNQTSRVTTSSLETLFNWYYFSVMVACFLSQSLLVFVQTTYG-------WQIGFGVSV 208

  Fly   313 VLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQL 377
            ..|.:||.:|......|                      .:.::...|.|..|     |....|.
plant   209 AAMALSVALFFAASPYY----------------------VRFQKPTRNSRNPW-----KLCRVQQ 246

  Fly   378 IDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGD--MGSWDIKPDQLQVLNPLLILIF 440
            ::|:|.|:.|:.::....:...:...|.|....||..||..  :..::|.|....:...:..|:|
plant   247 VEDLKSLINVIPIWSTGIILSLVTACQVSFIVLQAKTMDRHTFIQGFEIPPGSYGIFLVISFLLF 311

  Fly   441 IPLYDVALYPALKLVGIRRPLQKLTMGGILAGIAFIIS-------GVVELSLEKTYPD------- 491
            :.|||:.:.|.|.. .:|.|.:...|..:.||  ::||       ...|.:..||..|       
plant   312 LGLYDLVIVPLLSW-ALREPFRLGVMVRMWAG--YVISVLCISALAATEYARRKTARDESGTKLS 373

  Fly   492 ----LPYSQNIQLRIFNADNC---DYFFTSNIPGAENVTVTSLNAYTNKDIYAPGSLDVEFSLSS 549
                |||.  |...|..|.|.   :.||.|.:|...:...|:|:                 ||:.
plant   374 AMWLLPYM--ILGGIAEALNTIAQNEFFYSELPKTMSSVATTLS-----------------SLNM 419

  Fly   550 ASEACTISADKIPKVLTDNTAWSLFLNPLNGSG----YYW 585
            |: |..||:..|  .:.|.|.:..::......|    |||
plant   420 AA-ASLISSWII--TIVDVTTYGSWITENIDEGHLDYYYW 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2930NP_001284845.1 2A1704 145..776 CDD:273343 111/485 (23%)
PTR2 198..504 CDD:279226 77/342 (23%)
AT5G11570NP_196718.1 MFS_NPF1_2 20..476 CDD:340974 114/495 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4676
eggNOG 1 0.900 - - E1_COG3104
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I1193
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D365203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X63
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.