DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yin and AT3G45720

DIOPT Version :9

Sequence 1:NP_001284844.1 Gene:yin / 31340 FlyBaseID:FBgn0265575 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_190158.1 Gene:AT3G45720 / 823714 AraportID:AT3G45720 Length:555 Species:Arabidopsis thaliana


Alignment Length:416 Identity:91/416 - (21%)
Similarity:166/416 - (39%) Gaps:73/416 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IPYPKSVAFIISNEFCERFNYYGMRTILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALIA 131
            |.:|..:|.::......    ||....|:::|..:.......|..:.:.....:.:.|::.|::|
plant    24 ITFPFMIATLLGISVTS----YGWVLNLIVFLIEEYNIKSIAAAQISNIVNGCLSMLPVVTAILA 84

  Fly   132 DGWLGKYKTILYLSLVYSLG----AMVVSF----------GAVPLSGMPTK---AVTVVGLLLIA 179
            |.:.|....|...:.:..||    .::.||          |:: |...|:|   .|....|.|:.
plant    85 DSFFGNIPVISASAFISLLGIFLLTLISSFENLRPRPCETGSI-LCQSPSKLHLGVLYAALALVT 148

  Fly   180 IGTGGIKPCVSAFGGDQFSLPAQSFQLAKFFSLFYFAINAGSLISTTFTPILRADVHCFGDQDCF 244
            .||.|.:..:::.|.:|:..|...   ..||:.::..:|.|::||.|      |.|:. .:...:
plant   149 AGTSGTRVALASAGANQYDKPRDK---GSFFNWYFLTVNTGAIISAT------AIVYT-QENASW 203

  Fly   245 SLAFGVPAILMIFSVIIFMAGKRLYRCQPPAGNMIFGVSRCIADAF-------KGWQKRRHSE-- 300
            .|.||:.|...:.|.|:|::|||.|:...|.|:....:.|.:..|.       ...::..|.|  
plant   204 RLGFGLCAAANLISFIVFISGKRFYKHDKPMGSPFTSLIRVLVAAILKIKVVTSSKEEDYHREVE 268

  Fly   301 ---------PMESFLDYAKPTVGSRM--------------------VQETKCLGRILRLFLPFPV 336
                     |.:||....:..:.|..                    |::.|.:.|:|.|:|....
plant   269 KESKTCIGMPSKSFRFLNRAALKSEKDLNQEDGLCHNPWRLCSVEEVEDFKSVLRVLPLWLAILF 333

  Fly   337 FWALFDQQGSRWTFQATRMD-GNVLGFQIKPDQMQVVNPLLILGFLPLFDYIIYPALARCGIRR- 399
            .......|.|....||...| |....|::....:||:..:....||.|.::.|||...:...:: 
plant   334 VGTSIGVQASMTVLQALVTDRGLDSKFKVPAGSLQVIVLISSCVFLVLNNWTIYPIYQKITHKQL 398

  Fly   400 -PLQKLTLGLLLAALGFFLSAGLEMK 424
             |||::.:|.:...|...:||.:|.|
plant   399 TPLQQVGIGQVFNILSMAISAIVEAK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yinNP_001284844.1 2A1704 85..719 CDD:273343 88/398 (22%)
MFS 138..>398 CDD:304372 69/315 (22%)
AT3G45720NP_190158.1 MFS_NPF1_2 26..537 CDD:340974 90/414 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 120 1.000 Domainoid score I1880
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I1193
OMA 1 1.010 - - QHG55282
OrthoDB 1 1.010 - - D365203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X63
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.