DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yin and AT2G38100

DIOPT Version :9

Sequence 1:NP_001284844.1 Gene:yin / 31340 FlyBaseID:FBgn0265575 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001324906.1 Gene:AT2G38100 / 818388 AraportID:AT2G38100 Length:527 Species:Arabidopsis thaliana


Alignment Length:343 Identity:73/343 - (21%)
Similarity:132/343 - (38%) Gaps:64/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 ILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALIADGWLGKYKTILYLSLVYSLGAMVVSF 157
            :|:|||||::......|..:.:.|..:..|..|....:.|.::|.:..:...:|.:|.|...::.
plant    23 MLMLYLTNEMKLKFTDAAAIVNVFAGVSAIGHLGMQFLVDAFIGHFWMLCLSTLAFSFGFGFLAI 87

  Fly   158 GAVP-LSGMPTKAVTVVGLLLIAIGTGGIKPCVSAFGGDQFSLPAQSFQLAKFFSLFYFAI-NAG 220
            .|.| |||...|.:..|.|.:|::|..|....:..|..||..........||..|   |.| |.|
plant    88 SASPILSGNGQKGLFYVALTVISVGIFGRSISLGVFTEDQLEDGRNKGNPAKLVS---FVIGNVG 149

  Fly   221 SLISTTFTPILRADVHCFGDQDCFSLAFGVPAILMIFSVIIFMAGKRLYRCQPPAGNMIFGVSRC 285
            :.:......|....:      ..:.:.|.:|:...:.:::||::|...|:...|.|:.:..|.|.
plant   150 NFVFLLLAAIAMPQI------SPWFVRFTIPSGCEVLAMLIFISGACSYKRVKPGGSPLTTVFRV 208

  Fly   286 -IADAFKG-----------WQK-------RRHSEPMESFLDYAKPTVGSRM-------------- 317
             :|.|.|.           ::|       :.|:..:. :||.|...:.:..              
plant   209 FMASASKMSCAYSNNSSQLYEKAECDQDIKPHTSSLR-YLDRAAMILQTESLEQQRKNRWKLCRV 272

  Fly   318 --VQETKCLGRILRLFLPFPVFWALFDQQGSRWTFQATRMDGNVLGFQIKPDQMQVVNPLLILGF 380
              |::||.:.|.:.||....:...:|....:.:..||..||.....:.:.               
plant   273 TEVEQTKSVIRTVPLFATSLISGIVFSLGNTFFLEQANHMDSKFGSWNLP--------------- 322

  Fly   381 LPLFDYIIYPALARCGIR 398
            |||.  :::...||.|.|
plant   323 LPLL--LLFSEAARLGSR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yinNP_001284844.1 2A1704 85..719 CDD:273343 73/343 (21%)
MFS 138..>398 CDD:304372 60/296 (20%)
AT2G38100NP_001324906.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D365203at2759
OrthoFinder 1 1.000 - - FOG0000101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X63
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.